Immunotation of Rv3921c
From DrugPedia: A Wikipedia for Drug discovery
(New page: {{immunebox | Name =<Rv3921c> conserved membrane protein |image= | width=250 |image2= |Swiss Prot = P65626 | Genbank = | PDB =No structure available | DrugBank ...) |
|||
| Line 72: | Line 72: | ||
Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | ||
<br> | <br> | ||
| - | Result Predicited by []<br> | + | Result Predicited by [http://crdd.osdd.net/drugpedia/index.php/Image:Ppp1.txt]<br> |
==IEDB Analysis== | ==IEDB Analysis== | ||
Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | ||
| - | Result Predicted by [] | + | Result Predicted by [http://crdd.osdd.net/drugpedia/index.php/Image:Ppp2.txt] |
=MHC Class-II Binder= | =MHC Class-II Binder= | ||
==Propred Analysis== | ==Propred Analysis== | ||
Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | ||
| - | Result Predicted by [] | + | Result Predicted by [http://crdd.osdd.net/drugpedia/index.php/Image:Ppp3.txt] |
==NetMHC-II Analysis== | ==NetMHC-II Analysis== | ||
Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | ||
| - | Result Predicted by [] | + | Result Predicted by [http://crdd.osdd.net/drugpedia/index.php/Image:Ppp4.txt] |
=External Links= | =External Links= | ||
Revision as of 06:34, 2 February 2010
| Immunotation of Rv3921c
| |
| Name | |
| <Rv3921c> conserved membrane protein | |
| Identifiers | |
| Swiss Prot | |
| Genbank | ? |
| PDB | |
| Chemical data | |
| Formula | ? |
| Mol. wt. | 40884.2 |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 10.6257 |
Contents |
General
Protein Sequence
>Rv3921c, TB.seq 4408969:4410066 MW:40885 VSLLFDFFSLDFIYYPVSWIMWVWYRLFAFVLGPSNFFAWALSVMFLVFTLRALLYKPFVRQIRTTRQMQELQPQIKALQ KKYGKDRQRMALEMQKLQREHGFNPILGCLPMLAQIPVFLGLYHVLRSFNRTTGGFGQPHLSVIENRLTGNYVFSPVDVG HFLDANLFGAPIGAYMTQRSGLDAFVDFSRPALIAVGVPVMILAGIATYFNSRASIARQSAEAAANPQTAMMNKLALYVF PLGVVVGGPFLPLAIILYWFSNNIWTFGQQHYVFGMIEKEEEAKKQEAVRRRAANAPAPGAKPKRSPKTAPATNAAAPTE AGDTDDGAESDASTERPADTSNPARRNSGPSARTPRPGVRPKKRKR
Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|Q70CQ4 | 31 | 53 | 63 | 0.43 |
| sp|Q7RTS5 | 32 | 40 | 64 | 0.72 |
| sp|P08240 | 33 | 50 | 57 | 0.81 |
| sp|Q14202 | 26 | 43 | 87 | 0.84 |
| sp|Q8N954 | 26 | 47 | 82 | 0.92 |
Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
Subcellular Location
Link to TBpred
Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
B cell Epitopes
BCEpred Analysis
Link to Bcepred
Result Predicited by Bcepred
ABCpred Analysis
Link to ABCpred
Result Predicited by ABCPred
IEDB Analysis
Link to IEDB
Result Predicited by IEDB
MHC Class-I Binder
nHLAPred Analysis
Link to nHLApred
Result Predicited by [1]
IEDB Analysis
Link to IEDB
Result Predicted by [2]
MHC Class-II Binder
Propred Analysis
Link to Propred
Result Predicted by [3]
NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by [4]
External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
