Immunotation of Rv3340
From DrugPedia: A Wikipedia for Drug discovery
(→General) |
|||
| Line 31: | Line 31: | ||
AEQLATGVSPGLVRLAVGIEGIDDILADLELGFAAARRFSADPQSVAAF | AEQLATGVSPGLVRLAVGIEGIDDILADLELGFAAARRFSADPQSVAAF | ||
* | * | ||
| + | .3|CGL_HUMAN RecName: Full=Cystathionine gamma-lyase... 211 Gene info | ||
| + | .3|CDC23_HUMAN RecName: Full=Cell division cycle pro... 31.2 Gene info | ||
| + | .1|MYOME_HUMAN RecName: Full=Myomegalin; AltName: Fu... 30.0 Gene info | ||
| + | .2|DYH9_HUMAN RecName: Full=Dynein heavy chain 9, ax... 29.6 | ||
=Human Homologue Blast Result= | =Human Homologue Blast Result= | ||
| Line 38: | Line 42: | ||
<td>subject ids</td><td>% identity</td><td>% positives</td><td>alignment length</td><td> evalue</td></tr> | <td>subject ids</td><td>% identity</td><td>% positives</td><td>alignment length</td><td> evalue</td></tr> | ||
| - | <tr><td></td><td> </td><td> </td><td> </td><td> </td></tr> | + | <tr><td>sp|P32929</td><td> 34</td><td> 52</td><td> 403</td><td> 8e-55</td></tr> |
| - | <tr><td></td><td> </td><td> </td><td> </td><td> </td></tr> | + | <tr><td>sp|Q9UJX2</td><td> 23</td><td> 42</td><td> 94</td><td> 1.2</td></tr> |
| - | <tr><td></td><td> </td><td> </td><td> </td><td> </td></tr> | + | <tr><td>sp|Q5VU43</td><td> 35</td><td> 50</td><td> 62</td><td> 2.8 </td></tr> |
| + | |||
| + | <tr><td>sp|Q9NYC9</td><td> 30</td><td> 47</td><td> 71</td><td> 4.2</td></tr> | ||
| - | |||
| - | |||
=Alergen Protein= | =Alergen Protein= | ||
Revision as of 05:42, 1 February 2010
| Immunotation of Rv3340
| |
| Name | |
| O-acetylhomoserineaminocarboxypropyltransferase | |
| Identifiers | |
| Swiss Prot | |
| Genbank | |
| PDB | ? |
| Chemical data | |
| Formula | [] |
| Mol. wt. | 47370.6 Da |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 5.19 |
Contents |
General
In enzymology, an O-acetylhomoserine aminocarboxypropyltransferase is an enzyme that catalyzes the chemical reaction
O-acetyl-L-homoserine + methanethiol --- L-methionine + acetate
Thus, the two substrates of this enzyme are O-acetyl-L-homoserine and methanethiol, whereas its two products are L-methionine and acetate.
This enzyme belongs to the family of transferases, specifically those transferring aryl or alkyl groups other than methyl groups. The systematic name of this enzyme class is O-acetyl-L-homoserine:methanethiol 3-amino-3-carboxypropyltransferase. Other names in common use include O-acetyl-L-homoserine acetate-lyase (adding methanethiol), O-acetyl-L-homoserine sulfhydrolase, O-acetylhomoserine (thiol)-lyase, O-acetylhomoserine sulfhydrolase, and methionine synthase. This enzyme participates in methionine metabolism and cysteine metabolism.
Protein Sequence
>Rv3340, TB.seq 3726123:3727469 MW:47372 MSADSNSTDADPTAHWSFETKQIHAGQHPDPTTNARALPIYATTSYTFDDTAHAAALFGLEIPGNIYTRIGNPTTDVVEQ RIAALEGGVAALFLSSGQAAETFAILNLAGAGDHIVSSPRLYGGTYNLFHYSLAKLGIEVSFVDDPDDLDTWQAAVRPNT KAFFAETISNPQIDLLDTPAVSEVAHRNGVPLIVDNTIATPYLIQPLAQGADIVVHSATKYLGGHGAAIAGVIVDGGNFD WTQGRFPGFTTPDPSYHGVVFAELGPPAFALKARVQLLRDYGSAASPFNAFLVAQGLETLSLRIERHVANAQRVAEFLAA RDDVLSVNYAGLPSSPWHERAKRLAPKGTGAVLSFELAGGIEAGKAFVNALKLHSHVANIGDVRSLVIHPASTTHAQLSP AEQLATGVSPGLVRLAVGIEGIDDILADLELGFAAARRFSADPQSVAAF
.3|CGL_HUMAN RecName: Full=Cystathionine gamma-lyase... 211 Gene info .3|CDC23_HUMAN RecName: Full=Cell division cycle pro... 31.2 Gene info .1|MYOME_HUMAN RecName: Full=Myomegalin; AltName: Fu... 30.0 Gene info .2|DYH9_HUMAN RecName: Full=Dynein heavy chain 9, ax... 29.6
Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|P32929 | 34 | 52 | 403 | 8e-55 |
| sp|Q9UJX2 | 23 | 42 | 94 | 1.2 |
| sp|Q5VU43 | 35 | 50 | 62 | 2.8 |
| sp|Q9NYC9 | 30 | 47 | 71 | 4.2 |
