From DrugPedia: A Wikipedia for Drug discovery

Revision as of 19:11, 26 January 2010 (edit) AkhilSrivastava (Talk | contribs) ← Previous diff		Current revision (19:29, 26 January 2010) (edit) (undo) AkhilSrivastava (Talk | contribs)
Line 6:		Line 6:
	|Swiss Prot =  P66930		|Swiss Prot =  P66930
	| Genbank          = 887766		| Genbank          = 887766
-	| PDB        = 2AF6, 2GQ2	+	| PDB        = 2GQ2
	| DrugBank          =		| DrugBank          =
	| chemical_formula  = ?		| chemical_formula  = ?

---

Current revision

Immunotation of Rv2754c
Name
Thymidylate synthase thyX
Identifiers
Swiss Prot	P66930
Genbank	887766
PDB	2GQ2
Chemical data
Formula	?
Mol. wt.	32152.9 Da
Pharmacokinetic data
Bioavailability	?
Solubility	?
Isoelectric-Point	7.02

Contents 1 General 1.1 Protein Sequence 2 Human Homologue Blast Result 3 Alergen Protein 4 Bacterial Toxin Prediction 5 Subcellular Location 6 Antigens 6.1 B cell Epitopes 6.1.1 BCEpred Analysis 6.1.2 ABCpred Analysis 6.1.3 IEDB Analysis 7 MHC Class-I Binder 7.1 nHLAPred Analysis 7.2 IEDB Analysis 8 MHC Class-II Binder 8.1 Propred Analysis 8.2 NetMHC-II Analysis 9 External Links

[edit] General

flavin dependent thymidylate synthase; ThyX; thymidylate synthase complementing protein; catalyzes the formation of dTMP and tetrahydrofolate from dUMP and methylenetetrahydrofolate; the enzyme from Mycobacterium tuberculosis forms homotetramers; uses FAD as a cofactor

POSSIBLE MOLECULAR FUNTION

1.FAD Binding Interacting selectively and non-covalently with FAD, flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.

2.Thymidylate Synthase (FAD) Activity Catalysis of the reaction: 5,10-methylenetetrahydrofolate + dUMP + FADH2 = dTMP + tetrahydrofolate + FAD.

[edit] Protein Sequence

>Rv2754c, TB.seq 3067193:3067942 MW:27560 VAETAPLRVQLIAKTDFLAPPDVPWTTDADGGPALVEFAGRACYQSWSKPNPKTATNAGYLRHIIDVGHFSVLEHASVSF YITGISRSCTHELIRHRHFSYSQLSQRYVPEKDSRVVVPPGMEDDADLRHILTEAADAARATYSELLAKLEAKFADQPNA ILRRKQARQAARAVLPNATETRIVVTGNYRAWRHFIAMRASEHADVEIRRLAIECLRQLAAVAPAVFADFEVTTLADGTE VATSPLATEA

[edit] Human Homologue Blast Result

subject ids	% identity	% positives	alignment length	evalue
sp|O15245|	29	42	54	0.52
sp|Q5SXH7|	29	40	67	1.4
sp|O15068|	28	41	67	2.4
sp|P35520|	25	55	47	2.6
sp|Q9UI47|	32	52	61	9.5

[edit] Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

[edit] Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

[edit] Subcellular Location

Link to TBpred
Cytoplasmic protein

[edit] Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

[edit] B cell Epitopes

[edit] BCEpred Analysis

Link to Bcepred
Result Predicited by [1]

[edit] ABCpred Analysis

Link to ABCpred
Result Predicted By[2]

[edit] IEDB Analysis

Link to IEDB
Result Predicited by [ ]

[edit] MHC Class-I Binder

[edit] nHLAPred Analysis

Link to nHLApred
Result Predicited by nHLAPred

[edit] IEDB Analysis

Link to IEDB
Result Predicted by IEDB

[edit] MHC Class-II Binder

[edit] Propred Analysis

Link to Propred
Result Predicted by Propred

[edit] NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by [3]

[edit] External Links

• Database of Mycobacterium tuberculosis genome sequences and related information.