Immunotation of Rv2754c
From DrugPedia: A Wikipedia for Drug discovery
| Line 69: | Line 69: | ||
==B cell Epitopes== | ==B cell Epitopes== | ||
====BCEpred Analysis==== | ====BCEpred Analysis==== | ||
| - | Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred] | + | Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred]<br> |
| - | <br> | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Http_www.imtech.res.in_cg....pdf]<br> |
| - | + | ||
====ABCpred Analysis==== | ====ABCpred Analysis==== | ||
Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br> | Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br> | ||
| - | Result Predicted By | + | Result Predicted By[http://crdd.osdd.net/drugpedia/images/Abcpred_prediction.pdf]<br> |
====IEDB Analysis==== | ====IEDB Analysis==== | ||
Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br> | Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br> | ||
| + | Result Predicited by [ ]<br> | ||
| - | + | =MHC Class-I Binder= | |
| - | =MHC Class- | + | ==nHLAPred Analysis== |
| - | == | + | Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] |
| - | Link to [http://www.imtech.res.in/raghava/ | + | <br> |
| - | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/A_neural_network_based_MHC_....pdf nHLAPred]<br> | |
| - | + | ||
==IEDB Analysis== | ==IEDB Analysis== | ||
Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | ||
| - | + | Result Predicted by [http://crdd.osdd.net/drugpedia/images/Http_tools.immuneepitope.....pdf IEDB] | |
=MHC Class-II Binder= | =MHC Class-II Binder= | ||
==Propred Analysis== | ==Propred Analysis== | ||
Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | ||
| + | Result Predicted by [http://crdd.osdd.net/drugpedia/images/Prediction_Results.pdf Propred] | ||
==NetMHC-II Analysis== | ==NetMHC-II Analysis== | ||
Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | ||
| - | + | Result Predicted by [http://crdd.osdd.net/drugpedia/images/NetMHCII_2.0_Server_-_predi....pdf] | |
=External Links= | =External Links= | ||
Revision as of 19:11, 26 January 2010
| Immunotation of Rv2754c
| |
| Name | |
| Thymidylate synthase thyX | |
| Identifiers | |
| Swiss Prot | |
| Genbank | |
| PDB | |
| Chemical data | |
| Formula | ? |
| Mol. wt. | 32152.9 Da |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 7.02 |
Contents |
General
flavin dependent thymidylate synthase; ThyX; thymidylate synthase complementing protein; catalyzes the formation of dTMP and tetrahydrofolate from dUMP and methylenetetrahydrofolate; the enzyme from Mycobacterium tuberculosis forms homotetramers; uses FAD as a cofactor
POSSIBLE MOLECULAR FUNTION
1.FAD Binding Interacting selectively and non-covalently with FAD, flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.
2.Thymidylate Synthase (FAD) Activity Catalysis of the reaction: 5,10-methylenetetrahydrofolate + dUMP + FADH2 = dTMP + tetrahydrofolate + FAD.
Protein Sequence
>Rv2754c, TB.seq 3067193:3067942 MW:27560 VAETAPLRVQLIAKTDFLAPPDVPWTTDADGGPALVEFAGRACYQSWSKPNPKTATNAGYLRHIIDVGHFSVLEHASVSF YITGISRSCTHELIRHRHFSYSQLSQRYVPEKDSRVVVPPGMEDDADLRHILTEAADAARATYSELLAKLEAKFADQPNA ILRRKQARQAARAVLPNATETRIVVTGNYRAWRHFIAMRASEHADVEIRRLAIECLRQLAAVAPAVFADFEVTTLADGTE VATSPLATEA
Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|O15245| | 29 | 42 | 54 | 0.52 |
| sp|Q5SXH7| | 29 | 40 | 67 | 1.4 |
| sp|O15068| | 28 | 41 | 67 | 2.4 |
| sp|P35520| | 25 | 55 | 47 | 2.6 |
| sp|Q9UI47| | 32 | 52 | 61 | 9.5 |
Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
Subcellular Location
Link to TBpred
Cytoplasmic protein
Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
B cell Epitopes
BCEpred Analysis
Link to Bcepred
Result Predicited by [1]
ABCpred Analysis
Link to ABCpred
Result Predicted By[2]
IEDB Analysis
Link to IEDB
Result Predicited by [ ]
MHC Class-I Binder
nHLAPred Analysis
Link to nHLApred
Result Predicited by nHLAPred
IEDB Analysis
Link to IEDB
Result Predicted by IEDB
MHC Class-II Binder
Propred Analysis
Link to Propred
Result Predicted by Propred
NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by [3]
External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
