Immunotation of Rv2754c

From DrugPedia: A Wikipedia for Drug discovery

(Difference between revisions)
Jump to: navigation, search
(New page: {{immunebox | Name =<b> Thymidylate synthase thyX</b> |image= | width=250 |image2= |Swiss Prot = P66930 | Genbank = 887766 | PDB = 2AF6, 2GQ2 | DrugBank ...)
Line 8: Line 8:
| PDB        = 2AF6, 2GQ2
| PDB        = 2AF6, 2GQ2
| DrugBank          =
| DrugBank          =
-
| chemical_formula  = [http://pubchem.ncbi.nlm.nih.gov/summary/summary.cgi?cid=7711&loc=ec_rcs]
+
| chemical_formula  = ?
| molecular_weight  = 32152.9 Da
| molecular_weight  = 32152.9 Da
| solubility        =  
| solubility        =  

Revision as of 00:01, 25 January 2010

Immunotation of Rv2754c
Name
Thymidylate synthase thyX
Identifiers
Swiss Prot P66930
Genbank 887766
PDB 2GQ2 2AF6, 2GQ2
Chemical data
Formula  ?
Mol. wt. 32152.9 Da
Pharmacokinetic data
Bioavailability  ?
Solubility  ?
Isoelectric-Point 7.02

Contents

General

flavin dependent thymidylate synthase; ThyX; thymidylate synthase complementing protein; catalyzes the formation of dTMP and tetrahydrofolate from dUMP and methylenetetrahydrofolate; the enzyme from Mycobacterium tuberculosis forms homotetramers; uses FAD as a cofactor


POSSIBLE MOLECULAR FUNTION

1.FAD Binding Interacting selectively and non-covalently with FAD, flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.

2.Thymidylate Synthase (FAD) Activity Catalysis of the reaction: 5,10-methylenetetrahydrofolate + dUMP + FADH2 = dTMP + tetrahydrofolate + FAD.


Protein Sequence

>Rv2754c, TB.seq 3067193:3067942 MW:27560 VAETAPLRVQLIAKTDFLAPPDVPWTTDADGGPALVEFAGRACYQSWSKPNPKTATNAGYLRHIIDVGHFSVLEHASVSF YITGISRSCTHELIRHRHFSYSQLSQRYVPEKDSRVVVPPGMEDDADLRHILTEAADAARATYSELLAKLEAKFADQPNA ILRRKQARQAARAVLPNATETRIVVTGNYRAWRHFIAMRASEHADVEIRRLAIECLRQLAAVAPAVFADFEVTTLADGTE VATSPLATEA


Human Homologue Blast Result

subject ids% identity% positivesalignment length evalue
sp|O15245| 29 42 54 0.52
sp|Q5SXH7| 29 40 67 1.4
sp|O15068| 28 41 67 2.4
sp|P35520| 25 55 47 2.6
sp|Q9UI47| 32 52 61 9.5


Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

Subcellular Location

Link to TBpred
Cytoplasmic protein

Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

B cell Epitopes

BCEpred Analysis

Link to Bcepred


ABCpred Analysis

Link to ABCpred
Result Predicted By


IEDB Analysis

Link to IEDB


MHC Class-II Binder

Propred Analysis

Link to Propred


IEDB Analysis

Link to IEDB


MHC Class-II Binder

Propred Analysis

Link to Propred


NetMHC-II Analysis

Link to NetMHC-II


External Links

  • Database of Mycobacterium tuberculosis genome sequences and related information.