Immunotation of Rv2753c (dihydrodipicolinate synthase)
From DrugPedia: A Wikipedia for Drug discovery
(→BCEpred Analysis) |
(→B cell Epitopes) |
||
| Line 64: | Line 64: | ||
====ABCpred Analysis==== | ====ABCpred Analysis==== | ||
Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br> | Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br> | ||
| - | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Abcpred_rv2753c.pdf | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Abcpred_rv2753c.pdf ABCPred]<br> |
====IEDB Analysis==== | ====IEDB Analysis==== | ||
Result Predicted by [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br> | Result Predicted by [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br> | ||
| - | Result Predicited by [http://crdd.osdd.net/drugpedia/images/IEDB_rv2753c.pdf | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/IEDB_rv2753c.pdf IEDB]<br> |
=MHC Class-I Binder= | =MHC Class-I Binder= | ||
Revision as of 09:52, 5 January 2010
| Immunotation of Rv2753c (dihydrodipicolinate synthase)
| |
| Name | |
| Dihydrodipicolinate Synthase | |
| Identifiers | |
| Swiss Prot | |
| Genbank | |
| PDB | |
| Chemical data | |
| Formula | C28H37ClN4O6 [1] |
| Mol. wt. | 30,858 Da |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 5.57 |
Contents |
General
dapA catalyzes the formation of dihydrodipicolinate from L-aspartate 4-semialdehyde and pyruvate.
L-aspartate 4-semialdehyde + pyruvate = dihydrodipicolinate + 2H2O.
This protein is eesential for optimal growth of M.tb and found in the cytoplasm as predicted by the TBpred. HMMpfam found one domain PF00701 and has Helix Turn Helix secondary structure.
Protein Sequence
>Rv2753c, TB.seq 3066222:3067121 MW:30827 VTTVGFDVAARLGTLLTAMVTPFSGDGSLDTATAARLANHLVDQGCDGLVVSGTTGESPTTTDGEKIELLRAVLEAVGDR ARVIAGAGTYDTAHSIRLAKACAAEGAHGLLVVTPYYSKPPQRGLQAHFTAVADATELPMLLYDIPGRSAVPIEPDTIRA LASHPNIVGVKDAKADLHSGAQIMADTGLAYYSGDDALNLPWLAMGATGFISVIAHLAAGQLRELLSAFGSGDIATARKI NIAVAPLCNAMSRLGGVTLSKAGLRLQGIDVGDPRLPQVAATPEQIDALAADMRAASVLR
Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|Q9BXD5 | 28 | 46.33 | 300 | 3.00E-023 |
| sp|Q86XE5 | 26.57 | 46.15 | 286 | 4.00E-022 |
| sp|Q9UG63 | 26.49 | 37.75 | 151 | 0.45 |
| sp|O14556 | 22.09 | 50 | 86 | 2 |
| sp|Q7Z7B0 | 27.69 | 44.62 | 65 | 2.7 |
Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
Subcellular Location
Link to TBpred
Cyoplasmic
Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
B cell Epitopes
BCEpred Analysis
Link to Bcepred
Result Predicited by Bcepred
ABCpred Analysis
Link to ABCpred
Result Predicited by ABCPred
IEDB Analysis
Result Predicted by IEDB
Result Predicited by IEDB
MHC Class-I Binder
nHLAPred Analysis
Link to nHLApred
Result Predicited by Predicited by nHLApred
IEDB Analysis
Link to IEDB
Result Predicted by IEDB
MHC Class-II Binder
Propred Analysis
Link to Propred
Result Predicted by Propred
NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by NetMHC-II
External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
