Immunotation of Rv2753c (dihydrodipicolinate synthase)

From DrugPedia: A Wikipedia for Drug discovery

(Difference between revisions)
Jump to: navigation, search
(External Links)
(Alergen Protein)
Line 43: Line 43:
=Alergen Protein=
=Alergen Protein=
 +
Link to [http://www.imtech.res.in/raghava/algpred/ Algpred]
Non Allergen Predicted by AlgPred Server
Non Allergen Predicted by AlgPred Server
 +
==Bacterial Toxin Prediction==
 +
Link to [http://www.imtech.res.in/raghava/btxpred/submission.html btxpred]
 +
No Hit Fountd by btxpred server.
=Antigens=
=Antigens=

Revision as of 09:39, 5 January 2010

Immunotation of Rv2753c (dihydrodipicolinate synthase)
Name
Dihydrodipicolinate Synthase
Identifiers
Swiss Prot P63945
Genbank 888289
PDB 1XXX
Chemical data
Formula C28H37ClN4O6 [1]
Mol. wt. 30,858 Da
Pharmacokinetic data
Bioavailability  ?
Solubility  ?
Isoelectric-Point 5.57

Contents

General

dapA catalyzes the formation of dihydrodipicolinate from L-aspartate 4-semialdehyde and pyruvate.

L-aspartate 4-semialdehyde + pyruvate = dihydrodipicolinate + 2H2O.

This protein is eesential for optimal growth of M.tb and found in the cytoplasm as predicted by the WoLFPSORT and Subloc Server. HMMpfam found one domain PF00701 and has Helix Turn Helix secondary structure.

Protein Sequence

>Rv2753c, TB.seq 3066222:3067121 MW:30827 VTTVGFDVAARLGTLLTAMVTPFSGDGSLDTATAARLANHLVDQGCDGLVVSGTTGESPTTTDGEKIELLRAVLEAVGDR ARVIAGAGTYDTAHSIRLAKACAAEGAHGLLVVTPYYSKPPQRGLQAHFTAVADATELPMLLYDIPGRSAVPIEPDTIRA LASHPNIVGVKDAKADLHSGAQIMADTGLAYYSGDDALNLPWLAMGATGFISVIAHLAAGQLRELLSAFGSGDIATARKI NIAVAPLCNAMSRLGGVTLSKAGLRLQGIDVGDPRLPQVAATPEQIDALAADMRAASVLR

Human Homologue Blast Result

subject ids% identity% positivesalignment length evalue
sp|Q9BXD5 28 46.33 300 3.00E-023
sp|Q86XE5 26.57 46.15 286 4.00E-022
sp|Q9UG63 26.49 37.75 151 0.45
sp|O14556 22.09 50 86 2
sp|Q7Z7B0 27.69 44.62 65 2.7

Alergen Protein

Link to Algpred Non Allergen Predicted by AlgPred Server

Bacterial Toxin Prediction

Link to btxpred No Hit Fountd by btxpred server.

Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

B cell Epitopes

BCEpred Analysis

Link to Bcepred  
Result Predicited by Predicited by Bcepred

ABCpred Analysis

Link to ABCpred
Result Predicited by Predicited by ABCPred

IEDB Analysis

Result Predicted by IEDB
Result Predicited by Predicited by IEDB

MHC Class-I Binder

nHLAPred Analysis

Link to nHLApred
Result Predicited by Predicited by nHLApred

IEDB Analysis

Link to IEDB
Result Predicted by IEDB

MHC Class-II Binder

Propred Analysis

Link to Propred
Result Predicted by Propred


NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by NetMHC-II

External Links

  • Database of Mycobacterium tuberculosis genome sequences and related information.