From DrugPedia: A Wikipedia for Drug discovery

Revision as of 09:12, 5 January 2010 (edit) Deepak (Talk | contribs) (→Antigens) ← Previous diff		Revision as of 09:17, 5 January 2010 (edit) (undo) Deepak (Talk | contribs) (→External Links) Next diff →
Line 83:		Line 83:
	=External Links=		=External Links=
		+	* [http://www.biohealthbase.org/mycobacterium Database] of ''Mycobacterium tuberculosis'' genome sequences and related information.
	[[Category:C2D]]		[[Category:C2D]]
	[[Category:Mtb Immunotation]]		[[Category:Mtb Immunotation]]

---

Revision as of 09:17, 5 January 2010

Immunotation of Rv2753c (dihydrodipicolinate synthase)
Name
Dihydrodipicolinate Synthase
Identifiers
Swiss Prot	P63945
Genbank	888289
PDB	1XXX
Chemical data
Formula	C28H37ClN4O6 [1]
Mol. wt.	30,858 Da
Pharmacokinetic data
Bioavailability	?
Solubility	?
Isoelectric-Point	5.57

Contents 1 General 1.1 Protein Sequence 2 Human Homologue Blast Result 3 Alergen Protein 4 Antigens 4.1 B cell Epitopes 4.1.1 BCEpred Analysis 4.1.2 ABCpred Analysis 4.1.3 IEDB Analysis 5 MHC Class-I Binder 5.1 nHLAPred Analysis 5.2 IEDB Analysis 6 MHC Class-II Binder 6.1 Propred Analysis 6.2 NetMHC-II Analysis 7 External Links

General

dapA catalyzes the formation of dihydrodipicolinate from L-aspartate 4-semialdehyde and pyruvate.

L-aspartate 4-semialdehyde + pyruvate = dihydrodipicolinate + 2H₂O.

This protein is eesential for optimal growth of M.tb and found in the cytoplasm as predicted by the WoLFPSORT and Subloc Server. HMMpfam found one domain PF00701 and has Helix Turn Helix secondary structure.

Protein Sequence

>Rv2753c, TB.seq 3066222:3067121 MW:30827 VTTVGFDVAARLGTLLTAMVTPFSGDGSLDTATAARLANHLVDQGCDGLVVSGTTGESPTTTDGEKIELLRAVLEAVGDR ARVIAGAGTYDTAHSIRLAKACAAEGAHGLLVVTPYYSKPPQRGLQAHFTAVADATELPMLLYDIPGRSAVPIEPDTIRA LASHPNIVGVKDAKADLHSGAQIMADTGLAYYSGDDALNLPWLAMGATGFISVIAHLAAGQLRELLSAFGSGDIATARKI NIAVAPLCNAMSRLGGVTLSKAGLRLQGIDVGDPRLPQVAATPEQIDALAADMRAASVLR

Human Homologue Blast Result

subject ids	% identity	% positives	alignment length	evalue
sp|Q9BXD5	28	46.33	300	3.00E-023
sp|Q86XE5	26.57	46.15	286	4.00E-022
sp|Q9UG63	26.49	37.75	151	0.45
sp|O14556	22.09	50	86	2
sp|Q7Z7B0	27.69	44.62	65	2.7

Alergen Protein

Non Allergen Predicted by AlgPred Server

Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

B cell Epitopes

BCEpred Analysis

Link to Bcepred  
Result Predicited by Predicited by Bcepred

ABCpred Analysis

Link to ABCpred
Result Predicited by Predicited by ABCPred

IEDB Analysis

Result Predicted by IEDB
Result Predicited by Predicited by IEDB

MHC Class-I Binder

nHLAPred Analysis

Link to nHLApred
Result Predicited by Predicited by nHLApred

IEDB Analysis

Link to IEDB
Result Predicted by IEDB

MHC Class-II Binder

Propred Analysis

Link to Propred
Result Predicted by Propred

NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by NetMHC-II

External Links

• Database of Mycobacterium tuberculosis genome sequences and related information.