Rv2138
From DrugPedia: A Wikipedia for Drug discovery
(New page: {{immunebox | Name =<b> lipoprotein (LppL) </b> |image= | width=250 |image2= |Swiss Prot = O06237 | Genbank = 887303 | PDB = | DrugBank = | ...) |
(New page: {{immunebox | Name =<b> lipoprotein (LppL) </b> |image= | width=250 |image2= |Swiss Prot = O06237 | Genbank = 887303 | PDB = | DrugBank = | ...) |
Current revision
Rv2138
| |
Name | |
lipoprotein (LppL) | |
Identifiers | |
Swiss Prot | |
Genbank | |
PDB | ? |
Chemical data | |
Formula | C15H10BrNO4 [1] |
Mol. wt. | 36819 Da |
Pharmacokinetic data | |
Bioavailability | ? |
Solubility | ? |
Isoelectric-Point | 7.7892 |
Contents |
[edit] General
Function Unknown. Rv2138, (MTCY270.30c), len: 358 aa. Probable lppL, conserved lipoprotein, with appropriately placed lipoprotein signature (PS00013) strongly similar to hypothetical Mycobacterium leprae protein, Q49806. FASTA best: Q49806 B2126_F3_142. (298 aa) opt: 1495, E(): 0; (75.3% identity in 300 aa overlap). Essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) mutants available at TARGET website.
[edit] Protein Sequence
>Rv2138, TB.seq 2397328:2398401 MW:36819 LLTGNKPAVQRRFIGLLMLSVLVAGCSSNPLANFAPGYPPTIEPAQPAVSPPTSQDPAGAVRPLSGHPRAALFDNGTRQL VALRPGADSAAPASIMVFDDVHVAPRVIFLPGPAAALTSDDHGTAFLAARGGYFVADLSSGHTARVNVADAAHTDFTAIA RRSDGKLVLGSADGAVYTLAKNPAVDPASGAATVASRTKIFARVDALVTQGNTTVVLDRGQTSVTTIGADGHAQQALRAG QGATTMAADPLGRVLIADTRGGQLLVYGVDPLILRQAYPVRQAPYGLAGSRELAWVSQTASNTVIGYDLTTGIPVEKVRY PTVQQPNSLAFDETSDTLYVVSGSGAGVQVIEHAAGTR
[edit] Human Homologue Blast Result
subject ids | % identity | % positives | alignment length | evalue |
sp|Q6XZF7.1 | 40 | 54 | 37 | 0.47 |
sp|Q05BV3.3 | 22 | 39 | 204 | 0.58 |
sp|Q9UHB4.1 | 43 | 51 | 41 | 0.77 |
sp|P42858.1 | 26 | 45 | 45 | 1.5 |
sp|Q2Q1W2.1 | 22 | 40 | 149 | 2.3 |
[edit] Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
Integral Membrane
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by [2]
[edit] ABCpred Analysis
Link to ABCpred
Result Predicited by [3]
[edit] IEDB Analysis
Link to IEDB
Result Predicited by [4]
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result Predicited by [5]
[edit] IEDB Analysis
Link to IEDB
Result Predicted by [6]
[edit] MHC Class-II Binder
[edit] Propred Analysis
Link to Propred
Result Predicted by [7]
[edit] NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by [8]
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.