Rv1714

From DrugPedia: A Wikipedia for Drug discovery

(Difference between revisions)
Jump to: navigation, search
(New page: {{immunebox | Name =<b> oxidoreductase </b> |image= | width=250 |image2= |Swiss Prot = O53927 | Genbank = 885159 | PDB = | DrugBank = | chemi...)
Current revision (18:45, 26 March 2010) (edit) (undo)
(New page: {{immunebox | Name =<b> oxidoreductase </b> |image= | width=250 |image2= |Swiss Prot = O53927 | Genbank = 885159 | PDB = | DrugBank = | chemi...)
 

Current revision

Rv1714
Name
oxidoreductase
Identifiers
Swiss Prot O53927
Genbank 885159
PDB  ?
Chemical data
Formula C16H14ClN3OS [1]
Mol. wt. 27955 Da
Pharmacokinetic data
Bioavailability  ?
Solubility  ?
Isoelectric-Point 4.7751

Contents

[edit] General

FUNCTION UNKNOWN; PROBABLY INVOLVED IN CELLULAR METABOLISM. Rv1714, (MTV048.01), len: 270 aa. Probable oxidoreductase similar to many e.g. AE0010|AE001021_4 Archaeoglobus fulgidus section 79 (281 aa), FASTA scores: opt: 578, E(): 3.3e-31, (38.9% identity in 265 aa overlap). Also similar to several other M. tuberculosis oxidoreductases e.g. Rv1544, etc. Essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) mutants available at TARGET website

[edit] Protein Sequence

>Rv1714, TB.seq 1941851:1942660 MW:27955 VEEMALAQQVPNLGLARFSVQDKSILITGATGSLGRVAARALADAGARLTLAGGNSAGLAELVNGAGIDDAAVVTCRPDS LADAQQMVEAALGRYGRLDGVLVASGSNHVAPITEMAVEDFDAVMDANVRGAWLVCRAAGRVLLEQGQGGSVVLVSSVRG GLGNAAGYSAYCPSKAGTDLLAKTLAAEWGGHGIRVNALAPTVFRSAVTEWMFTDDPKGRATREAMLARIPLRRFAEPED FVGALIYLLSDASSFYTGQVMYLDGGYTAC




[edit] Human Homologue Blast Result

subject ids% identity% positivesalignment length evalue
sp|Q7Z4W1.2 34 51 249 3e-29
sp|Q9BTZ2.2 30 51 257 2e-22
sp|Q8N4T8.3 31 47 245 4e-22
sp|Q9BY49.2 24 47 257 3e-19
sp|Q92506.2 28 48 251 1e-17



[edit] Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

[edit] Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

[edit] Subcellular Location

Link to TBpred
Cytoplasmic

[edit] Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

[edit] B cell Epitopes

[edit] BCEpred Analysis

Link to Bcepred
Result Predicited by [2]

[edit] ABCpred Analysis

Link to ABCpred
Result Predicited by [3]

[edit] IEDB Analysis

Link to IEDB
Result Predicited by [4]

[edit] MHC Class-I Binder

[edit] nHLAPred Analysis

Link to nHLApred
Result Predicited by [5]

[edit] IEDB Analysis

Link to IEDB
Result Predicted by [6]

[edit] MHC Class-II Binder

[edit] Propred Analysis

Link to Propred
Result Predicted by [7]


[edit] NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by [8]

[edit] External Links

  • Database of Mycobacterium tuberculosis genome sequences and related information.