From DrugPedia: A Wikipedia for Drug discovery

Revision as of 18:41, 22 March 2010 (edit) Nitinkumar (Talk | contribs) (New page: {{immunebox | Name =<b> FtsW-like protein FtsW </b> |image= | width=250 |image2= |Swiss Prot = P63762 | Genbank = 887916 | PDB = 2JAY | DrugBank ...) ← Previous diff		Current revision (18:41, 22 March 2010) (edit) (undo) Nitinkumar (Talk | contribs)
Line 6:		Line 6:
	|Swiss Prot = P63762		|Swiss Prot = P63762
	| Genbank          = 887916		| Genbank          = 887916
-	| PDB        =  2JAY	+	| PDB        =
	| DrugBank          =		| DrugBank          =

---

Current revision

Rv2154c
Name
FtsW-like protein FtsW
Identifiers
Swiss Prot	P63762
Genbank	887916
PDB	?
Chemical data
Formula	C13H21NO3 [1]
Mol. wt.	56306 Da
Pharmacokinetic data
Bioavailability	?
Solubility	?
Isoelectric-Point	11.65

Contents 1 General 1.1 Protein Sequence 2 Human Homologue Blast Result 3 Alergen Protein 4 Bacterial Toxin Prediction 5 Subcellular Location 6 Antigens 6.1 B cell Epitopes 6.1.1 BCEpred Analysis 6.1.2 ABCpred Analysis 6.1.3 IEDB Analysis 7 MHC Class-I Binder 7.1 nHLAPred Analysis 7.2 IEDB Analysis 8 MHC Class-II Binder 8.1 Propred Analysis 8.2 NetMHC-II Analysis 9 External Links

[edit] General

Genetic Information Processing; Replication and Repair; Chromosome Rv2154c, (MTCY270.14), len: 524 aa. Probable ftsW, cell division protein, related to MTCY10H4.17c, 3.2e-17. FASTA best: SP5E_BACSU P07373 stage V sporulation protein E (366 aa) opt: 755, E(): 1.6e-33; (38.4% identity in 357 aa overlap) Essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) mutants available at TARGET website

[edit] Protein Sequence

>Rv2154c, TB.seq 2413349:2414920 MW:56306 VLTRLLRRGTSDTDGSQTRGAEPVEGQRTGPEEASNPGSARPRTRFGAWLGRPMTSFHLIIAVAALLTTLGLIMVLSASA VRSYDDDGSAWVIFGKQVLWTLVGLIGGYVCLRMSVRFMRRIAFSGFAITIVMLVLVLVPGIGKEANGSRGWFVVAGFSM QPSELAKMAFAIWGAHLLAARRMERASLREMLIPLVPAAVVALALIVAQPDLGQTVSMGIILLGLLWYAGLPLRVFLSSL AAVVVSAAILAVSAGYRSDRVRSWLNPENDPQDSGYQARQAKFALAQGGIFGDGLGQGVAKWNYLPNAHNDFIFAIIGEE LGLVGALGLLGLFGLFAYTGMRIASRSADPFLRLLTATTTLWVLGQAFINIGYVIGLLPVTGLQLPLISAGGTSTAATLS LIGIIANAARHEPEAVAALRAGRDDKVNRLLRLPLPEPYLPPRLEAFRDRKRANPQPAQTQPARKTPRTAPGQPARQMGL PPRPGSPRTADPPVRRSVHHGAGQRYAGQRRTRRVRALEGQRYG

[edit] Human Homologue Blast Result

subject ids	% identity	% positives	alignment length	evalue
sp|Q15746.3	28	38	102	0.24
sp|Q9Y6V0.3	27	37	58	1.4
sp|O14513.2	37	50	40	1.6
sp|P11137.4	25	33	89	1.6
sp|P15822.3	28	41	75	2.1

[edit] Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

[edit] Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

[edit] Subcellular Location

Link to TBpred
Integral Membrane

[edit] Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

[edit] B cell Epitopes

[edit] BCEpred Analysis

Link to Bcepred
Result Predicited by [2]

[edit] ABCpred Analysis

Link to ABCpred
Result Predicited by [3]

[edit] IEDB Analysis

Link to IEDB
Result Predicited by [4]

[edit] MHC Class-I Binder

[edit] nHLAPred Analysis

Link to nHLApred
Result Predicited by [5]

[edit] IEDB Analysis

Link to IEDB
Result Predicted by [6]

[edit] MHC Class-II Binder

[edit] Propred Analysis

Link to Propred
Result Predicted by [7]

[edit] NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by [8]

[edit] External Links

• Database of Mycobacterium tuberculosis genome sequences and related information.