Rv2152c
From DrugPedia: A Wikipedia for Drug discovery
(New page: {{immunebox | Name =<b> UDP-N-acetylmuramate--L-alanine ligase </b> |image= | width=250 |image2= |Swiss Prot = P65472 | Genbank = 887983 | PDB = | DrugB...) |
(New page: {{immunebox | Name =<b> UDP-N-acetylmuramate--L-alanine ligase </b> |image= | width=250 |image2= |Swiss Prot = P65472 | Genbank = 887983 | PDB = | DrugB...) |
Current revision
Rv2152c
| |
Name | |
UDP-N-acetylmuramate--L-alanine ligase | |
Identifiers | |
Swiss Prot | |
Genbank | |
PDB | ? |
Chemical data | |
Formula | C9H10BrNO [1] |
Mol. wt. | 51146 Da |
Pharmacokinetic data | |
Bioavailability | ? |
Solubility | ? |
Isoelectric-Point | 6.61 |
Contents |
[edit] General
INVOLVED IN CELL WALL FORMATION; PEPTIDOGLYCAN BIOSYNTHESIS Rv2152c, (MTCY270.16), len: 494 aa. Probable murC, UDP-N-acetylmuramate-alanine ligase (see citation below), similar to others e.g. MURC_ECOLI|P17952 (491 aa), FASTA scores: opt: 764, E(): 0, (36.9% identity in 474 aa overlap); etc. Essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) mutants available at TARGET website
[edit] Protein Sequence
>Rv2152c, TB.seq 2410639:2412120 MW:51146 VSTEQLPPDLRRVHMVGIGGAGMSGIARILLDRGGLVSGSDAKESRGVHALRARGALIRIGHDASSLDLLPGGATAVVTT HAAIPKTNPELVEARRRGIPVVLRPAVLAKLMAGRTTLMVTGTHGKTTTTSMLIVALQHCGLDPSFAVGGELGEAGTNAH HGSGDCFVAEADESDGSLLQYTPHVAVITNIESDHLDFYGSVEAYVAVFDSFVERIVPGGALVVCTDDPGGAALAQRATE LGIRVLRYGSVPGETMAATLVSWQQQGVGAVAHIRLASELATAQGPRVMRLSVPGRHMALNALGALLAAVQIGAPADEVL DGLAGFEGVRRRFELVGTCGVGKASVRVFDDYAHHPTEISATLAAARMVLEQGDGGRCMVVFQPHLYSRTKAFAAEFGRA LNAADEVFVLDVYGAREQPLAGVSGASVAEHVTVPMRYVPDFSAVAQQVAAAASPGDVIVTMGAGDVTLLGPEILTALRV RANRSAPGRPGVLG
[edit] Human Homologue Blast Result
subject ids | % identity | % positives | alignment length | evalue |
sp|Q3SY77.1 | 37 | 50 | 59 | 0.42 |
sp|Q68DA7.2 | 33 | 48 | 39 | 3 |
sp|P61160.1 | 32 | 47 | 53 | 3.6 |
sp|Q6NUS8.1 | 34 | 52 | 50 | 7.2 |
[edit] Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
Cytoplasmic
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by [2]
[edit] ABCpred Analysis
Link to ABCpred
Result Predicited by [3]
[edit] IEDB Analysis
Link to IEDB
Result Predicited by [4]
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result Predicited by [5]
[edit] IEDB Analysis
Link to IEDB
Result Predicted by [6]
[edit] MHC Class-II Binder
[edit] Propred Analysis
Link to Propred
Result Predicted by [7]
[edit] NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by [8]
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.