Immunotation of Rv3918c
From DrugPedia: A Wikipedia for Drug discovery
| Line 42: | Line 42: | ||
Link to [http://www.imtech.res.in/raghava/algpred/ Algpred]<br> | Link to [http://www.imtech.res.in/raghava/algpred/ Algpred]<br> | ||
Non Allergen Predicted by AlgPred Server | Non Allergen Predicted by AlgPred Server | ||
| + | =Bacterial Toxin Prediction= | ||
| + | Link to [http://www.imtech.res.in/raghava/btxpred/submission.html btxpred]<br> | ||
| + | No Hit Fountd by btxpred server. | ||
| + | =Subcellular Location= | ||
| + | Link to [http://www.imtech.res.in/raghava/tbpred/ TBpred]<br> | ||
| + | integral membrane protein | ||
| + | =Antigens= | ||
| + | No Hit Found in [http://www.imtech.res.in/raghava/antigendb/keyquery.html AntigenDB]<br> | ||
| + | No. Hit Found in [http://www.iedb.org/ IEDB] | ||
| + | ==B cell Epitopes== | ||
| + | ====BCEpred Analysis==== | ||
| + | |||
| + | Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred] | ||
| + | <br> | ||
| + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Bcepred_rv2753.pdf Bcepred]<br> | ||
| + | |||
| + | ====ABCpred Analysis==== | ||
| + | Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br> | ||
| + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Abcpred_rv2753c.pdf ABCPred]<br> | ||
| + | |||
| + | ====IEDB Analysis==== | ||
| + | Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br> | ||
| + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/IEDB_rv2753c.pdf IEDB]<br> | ||
| + | =MHC Class-I Binder= | ||
| + | ==nHLAPred Analysis== | ||
| + | Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | ||
| + | <br> | ||
| + | Result Predicited by [http://crdd.osdd.net/drugpedia/index.php/Image:Bb1.txt]<br> | ||
| + | ==IEDB Analysis== | ||
| + | Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | ||
| + | Result Predicted by [http://crdd.osdd.net/drugpedia/index.php/Image:Bb2.txt] | ||
| + | |||
| + | =MHC Class-II Binder= | ||
| + | ==Propred Analysis== | ||
| + | Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | ||
| + | Result Predicted by [http://crdd.osdd.net/drugpedia/index.php/Image:Bb3.txt] | ||
| + | |||
| + | |||
| + | ==NetMHC-II Analysis== | ||
| + | Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | ||
| + | Result Predicted by [] | ||
| + | |||
| + | =External Links= | ||
| + | * [http://www.biohealthbase.org/mycobacterium Database] of ''Mycobacterium tuberculosis'' genome sequences and related information. | ||
| + | |||
| + | [[Category:C2D]] | ||
| + | [[Category:Mtb Immunotation]] | ||
Revision as of 07:28, 2 February 2010
| Immunotation of Rv3918c
| |
| Name | |
| <Rv3918c> | |
| Identifiers | |
| Swiss Prot | |
| Genbank | ? |
| PDB | |
| Chemical data | |
| Formula | ? |
| Mol. wt. | 37516.7 |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 6.2621 |
Contents |
General
Rv3918c, (MTV028.09c), len: 347. Unknown, similar to TR:O05189(EMBL:U87804) CHROMOSOME PARTITIONING PROTEIN PARA from CAULOBACTER CRESCENTUS (266 aa), fasta scores; opt:787 z-score: 990.9 E(): 0, 50.6% identity in 261 aa overlapand to SOJ_BACSU P37522 soj protein. bacillus subtilis. 11/95 (253aa),fasta scores; opt: 837 z-score: 1062.3 E(): 0,52.2% identity in 251 aa overlap. Possible alternative startsite at aa 107. Also similar to other M. tuberculosis proteins MTCI125.30 (E(): 4.3e-32, 35.2% identity in 327 aa overlap) and MTCY07D11.13 (E(): 3e-30, 39.9% identity in 263aaoverlap). Updated info: Functional Category: cell wall and cell processes. EC:
Protein Sequence
>Rv3918c, TB.seq 4406488:4407528 MW:37518 VSAPWGPVAAGPSALVRSGQASTIEPFQREMTPPTPTPEAAHNPTMNVSRETSTEFDTPIGAAAERAMRVLHTTHEPLQR PGRRRVLTIANQKGGVGKTTTAVNIAAALAVQGLKTLVIDLDPQGNASTALGITDRQSGTPSSYEMLIGEVSLHTALRRS PHSERLFCIPATIDLAGAEIELVSMVARENRLRTALAALDNFDFDYVFVDCPPSLGLLTINALVAAPEVMIPIQCEYYAL EGVSQLMRNIEMVKAHLNPQLEVTTVILTMYDGRTKLADQVADEVRQYFGSKVLRTVIPRSVKVSEAPGYSMTIIDYDPG SRGAMSYLDASRELAERDRPPSAKGRP
Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|Q8TB37 | 27 | 42 | 280 | 5e-05 |
| sp|Q9Y5Y2 | 38 | 58 | 50 | 0.010 |
| sp|Q9H9Y4 | 25 | 35 | 129 | 0.34 |
| sp|Q8WXH0 | 26 | 44 | 99 | 0.99 |
| sp|Q5TAX3 | 41 | 50 | 34 | 1.5 |
Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
Subcellular Location
Link to TBpred
integral membrane protein
Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
B cell Epitopes
BCEpred Analysis
Link to Bcepred
Result Predicited by Bcepred
ABCpred Analysis
Link to ABCpred
Result Predicited by ABCPred
IEDB Analysis
Link to IEDB
Result Predicited by IEDB
MHC Class-I Binder
nHLAPred Analysis
Link to nHLApred
Result Predicited by [1]
IEDB Analysis
Link to IEDB
Result Predicted by [2]
MHC Class-II Binder
Propred Analysis
Link to Propred
Result Predicted by [3]
NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by []
External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
