Immunotation of Rv3921c
From DrugPedia: A Wikipedia for Drug discovery
(→General) |
(→General) |
||
| Line 14: | Line 14: | ||
}} | }} | ||
=General= | =General= | ||
| - | Rv3921c, (MTV028.12c), len: 366. Unknown membrane protein, equivalent to M. leprae TR:Q50205 (EMBL:L39923) L222-ORF13 (312 aa), fasta scores; opt: 1770 z-score: 2084.5 E(): 0, 88.2% identity in 288 aa overlap | + | Rv3921c, (MTV028.12c), len: 366. Unknown membrane protein, equivalent to M. leprae TR:Q50205 (EMBL:L39923) L222-ORF13 (312 aa), fasta scores; opt: 1770 z-score: 2084.5 E(): 0, 88.2% identity in 288 aa overlap.The primary data source for this dataset was the full genome sequence of Mycobacterium tuberculosis strain H37Rv, derived from Genbank entry AL123456. This dataset was derived computationally using the PathoLogic program. |
| - | + | ||
| + | |||
==Protein Sequence== | ==Protein Sequence== | ||
>Rv3921c, TB.seq 4408969:4410066 MW:40885 | >Rv3921c, TB.seq 4408969:4410066 MW:40885 | ||
Current revision
| Immunotation of Rv3921c
| |
| Name | |
| <Rv3921c> conserved membrane protein | |
| Identifiers | |
| Swiss Prot | |
| Genbank | ? |
| PDB | |
| Chemical data | |
| Formula | ? |
| Mol. wt. | 40884.2 |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 10.6257 |
Contents |
[edit] General
Rv3921c, (MTV028.12c), len: 366. Unknown membrane protein, equivalent to M. leprae TR:Q50205 (EMBL:L39923) L222-ORF13 (312 aa), fasta scores; opt: 1770 z-score: 2084.5 E(): 0, 88.2% identity in 288 aa overlap.The primary data source for this dataset was the full genome sequence of Mycobacterium tuberculosis strain H37Rv, derived from Genbank entry AL123456. This dataset was derived computationally using the PathoLogic program.
[edit] Protein Sequence
>Rv3921c, TB.seq 4408969:4410066 MW:40885 VSLLFDFFSLDFIYYPVSWIMWVWYRLFAFVLGPSNFFAWALSVMFLVFTLRALLYKPFVRQIRTTRQMQELQPQIKALQ KKYGKDRQRMALEMQKLQREHGFNPILGCLPMLAQIPVFLGLYHVLRSFNRTTGGFGQPHLSVIENRLTGNYVFSPVDVG HFLDANLFGAPIGAYMTQRSGLDAFVDFSRPALIAVGVPVMILAGIATYFNSRASIARQSAEAAANPQTAMMNKLALYVF PLGVVVGGPFLPLAIILYWFSNNIWTFGQQHYVFGMIEKEEEAKKQEAVRRRAANAPAPGAKPKRSPKTAPATNAAAPTE AGDTDDGAESDASTERPADTSNPARRNSGPSARTPRPGVRPKKRKR
[edit] Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|Q70CQ4 | 31 | 53 | 63 | 0.43 |
| sp|Q7RTS5 | 32 | 40 | 64 | 0.72 |
| sp|P08240 | 33 | 50 | 57 | 0.81 |
| sp|Q14202 | 26 | 43 | 87 | 0.84 |
| sp|Q8N954 | 26 | 47 | 82 | 0.92 |
[edit] Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
INTEGRAL MEMBRANE PROTEIN
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by Bcepred
[edit] ABCpred Analysis
Link to ABCpred
Result Predicited by ABCPred
[edit] IEDB Analysis
Link to IEDB
Result Predicited by IEDB
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result Predicited by [1]
[edit] IEDB Analysis
Link to IEDB
Result Predicted by [2]
[edit] MHC Class-II Binder
[edit] Propred Analysis
Link to Propred
Result Predicted by [3]
[edit] NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by [4]
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
