Immunotation of Rv3340
From DrugPedia: A Wikipedia for Drug discovery
(→MHC Class-I Binder) |
|||
Line 78: | Line 78: | ||
Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | ||
<br> | <br> | ||
- | Result Predicited by []<br> | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/C11.pdf]<br> |
==IEDB Analysis== | ==IEDB Analysis== | ||
Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | ||
- | Result Predicted by [] | + | Result Predicted by [http://crdd.osdd.net/drugpedia/images/D1.txt] |
=MHC Class-II Binder= | =MHC Class-II Binder= |
Revision as of 08:07, 1 February 2010
Immunotation of Rv3340
| |
Name | |
O-acetylhomoserineaminocarboxypropyltransferase | |
Identifiers | |
Swiss Prot | |
Genbank | |
PDB | ? |
Chemical data | |
Formula | [] |
Mol. wt. | 47370.6 Da |
Pharmacokinetic data | |
Bioavailability | ? |
Solubility | ? |
Isoelectric-Point | 5.19 |
Contents |
General
In enzymology, an O-acetylhomoserine aminocarboxypropyltransferase is an enzyme that catalyzes the chemical reaction
O-acetyl-L-homoserine + methanethiol --- L-methionine + acetate
Thus, the two substrates of this enzyme are O-acetyl-L-homoserine and methanethiol, whereas its two products are L-methionine and acetate.
This enzyme belongs to the family of transferases, specifically those transferring aryl or alkyl groups other than methyl groups. The systematic name of this enzyme class is O-acetyl-L-homoserine:methanethiol 3-amino-3-carboxypropyltransferase. Other names in common use include O-acetyl-L-homoserine acetate-lyase (adding methanethiol), O-acetyl-L-homoserine sulfhydrolase, O-acetylhomoserine (thiol)-lyase, O-acetylhomoserine sulfhydrolase, and methionine synthase. This enzyme participates in methionine metabolism and cysteine metabolism.
Protein Sequence
>Rv3340, TB.seq 3726123:3727469 MW:47372 MSADSNSTDADPTAHWSFETKQIHAGQHPDPTTNARALPIYATTSYTFDDTAHAAALFGLEIPGNIYTRIGNPTTDVVEQ RIAALEGGVAALFLSSGQAAETFAILNLAGAGDHIVSSPRLYGGTYNLFHYSLAKLGIEVSFVDDPDDLDTWQAAVRPNT KAFFAETISNPQIDLLDTPAVSEVAHRNGVPLIVDNTIATPYLIQPLAQGADIVVHSATKYLGGHGAAIAGVIVDGGNFD WTQGRFPGFTTPDPSYHGVVFAELGPPAFALKARVQLLRDYGSAASPFNAFLVAQGLETLSLRIERHVANAQRVAEFLAA RDDVLSVNYAGLPSSPWHERAKRLAPKGTGAVLSFELAGGIEAGKAFVNALKLHSHVANIGDVRSLVIHPASTTHAQLSP AEQLATGVSPGLVRLAVGIEGIDDILADLELGFAAARRFSADPQSVAAF
Human Homologue Blast Result
subject ids | % identity | % positives | alignment length | evalue |
sp|P32929 | 34 | 52 | 403 | 8e-55 |
sp|Q9UJX2 | 23 | 42 | 94 | 1.2 |
sp|Q5VU43 | 35 | 50 | 62 | 2.8 |
sp|Q9NYC9 | 30 | 47 | 71 | 4.2 |
Alergen Protein
Link to Algpred
Allergen Predicted by AlgPred Server
Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
Subcellular Location
Link to TBpred
Integral Membrane Protein
Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
B cell Epitopes
BCEpred Analysis
Link to Bcepred
Result Predicited by [1]
ABCpred Analysis
Link to ABCpred
Result Predicited by [2]
IEDB Analysis
Link to IEDB
Result Predicited by [3]
MHC Class-I Binder
nHLAPred Analysis
Link to nHLApred
Result Predicited by [4]
IEDB Analysis
Link to IEDB
Result Predicted by [5]
MHC Class-II Binder
Propred Analysis
Link to Propred
Result Predicted by []
NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by []
External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.