Immunotation of Rv2753c (dihydrodipicolinate synthase)
From DrugPedia: A Wikipedia for Drug discovery
(→MHC Class-I Binder) |
(→MHC Class-I Binder) |
||
Line 59: | Line 59: | ||
=MHC Class-I Binder= | =MHC Class-I Binder= | ||
- | + | Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | |
- | + | ||
- | [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | + | |
<br> | <br> | ||
- | Result Predicited by [http://www.imtech.res.in/raghava/propred/ Propred] | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Nhlapred_rv2753c.pdf Predicited by nHLApred]<br> |
+ | |||
+ | Link to [http://www.imtech.res.in/raghava/propred/ Propred] | ||
=Alergen Protein= | =Alergen Protein= |
Revision as of 07:57, 5 January 2010
Immunotation of Rv2753c (dihydrodipicolinate synthase)
| |
Name | |
Dihydrodipicolinate Synthase | |
Identifiers | |
Swiss Prot | |
Genbank | |
PDB | |
Chemical data | |
Formula | C28H37ClN4O6 [1] |
Mol. wt. | 30,858 Da |
Pharmacokinetic data | |
Bioavailability | ? |
Solubility | ? |
Isoelectric-Point | 5.57 |
Contents |
General
dapA catalyzes the formation of dihydrodipicolinate from L-aspartate 4-semialdehyde and pyruvate.
L-aspartate 4-semialdehyde + pyruvate = dihydrodipicolinate + 2H2O.
This protein is eesential for optimal growth of M.tb and found in the cytoplasm as predicted by the WoLFPSORT and Subloc Server. HMMpfam found one domain PF00701 and has Helix Turn Helix secondary structure.
Protein Sequence
>Rv2753c, TB.seq 3066222:3067121 MW:30827 VTTVGFDVAARLGTLLTAMVTPFSGDGSLDTATAARLANHLVDQGCDGLVVSGTTGESPTTTDGEKIELLRAVLEAVGDR ARVIAGAGTYDTAHSIRLAKACAAEGAHGLLVVTPYYSKPPQRGLQAHFTAVADATELPMLLYDIPGRSAVPIEPDTIRA LASHPNIVGVKDAKADLHSGAQIMADTGLAYYSGDDALNLPWLAMGATGFISVIAHLAAGQLRELLSAFGSGDIATARKI NIAVAPLCNAMSRLGGVTLSKAGLRLQGIDVGDPRLPQVAATPEQIDALAADMRAASVLR
Human Homologue Blast Result
subject ids | % identity | % positives | alignment length | evalue |
sp|Q9BXD5 | 28 | 46.33 | 300 | 3.00E-023 |
sp|Q86XE5 | 26.57 | 46.15 | 286 | 4.00E-022 |
sp|Q9UG63 | 26.49 | 37.75 | 151 | 0.45 |
sp|O14556 | 22.09 | 50 | 86 | 2 |
sp|Q7Z7B0 | 27.69 | 44.62 | 65 | 2.7 |
Antigens
Epitopes
B-Cell Epitopes
BCEpred
Link to bcelpep
Result Predicited by Predicited by ABCPred
ABCpred Results
Link to ABCpred
Result Predicited by Predicited by ABCPred
IEBB Analysis
Result Predicted by IEDB
Result Predicited by Predicited by IEDB
MHC Class-I Binder
Link to nHLApred
Result Predicited by Predicited by nHLApred
Link to Propred
Alergen Protein
Non Allergen Predicted by AlgPred Server