Rv0208c
From DrugPedia: A Wikipedia for Drug discovery
(New page: {{immunebox | Name =<b> tRNA (guanine-N(7)-)-methyltransferase </b> |image= | width=250 |image2= |Swiss Prot = P67498 | Genbank = 886740 | PDB = 2QKX 3D8V 3D...) |
|||
| Line 6: | Line 6: | ||
|Swiss Prot = P67498 | |Swiss Prot = P67498 | ||
| Genbank = 886740 | | Genbank = 886740 | ||
| - | | PDB = | + | | PDB = |
| DrugBank = | | DrugBank = | ||
| chemical_formula = C16H15Cl2NO2 [http://pubchem.ncbi.nlm.nih.gov/summary/summary.cgi?cid=886740&loc=ec_rcs] | | chemical_formula = C16H15Cl2NO2 [http://pubchem.ncbi.nlm.nih.gov/summary/summary.cgi?cid=886740&loc=ec_rcs] | ||
| Line 63: | Line 63: | ||
Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred] | Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred] | ||
<br> | <br> | ||
| - | Result Predicited by | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Rv0208.pdf]<br> |
====ABCpred Analysis==== | ====ABCpred Analysis==== | ||
Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br> | Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br> | ||
| - | Result Predicited by | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Rv02081.pdf]<br> |
====IEDB Analysis==== | ====IEDB Analysis==== | ||
Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br> | Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br> | ||
| - | Result Predicited by | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Rv02082.pdf]<br> |
=MHC Class-I Binder= | =MHC Class-I Binder= | ||
| Line 77: | Line 77: | ||
Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | ||
<br> | <br> | ||
| - | Result Predicited by [http://crdd.osdd.net/drugpedia/images/ | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Rv02083.pdf]<br> |
==IEDB Analysis== | ==IEDB Analysis== | ||
Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | ||
| - | Result Predicted by [http://crdd.osdd.net/drugpedia/images/ | + | Result Predicted by [http://crdd.osdd.net/drugpedia/images/Rv02084.txt]<br> |
=MHC Class-II Binder= | =MHC Class-II Binder= | ||
==Propred Analysis== | ==Propred Analysis== | ||
Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | ||
| - | Result Predicted by | + | Result Predicted by [http://crdd.osdd.net/drugpedia/images/Rv02085.pdf]<br> |
==NetMHC-II Analysis== | ==NetMHC-II Analysis== | ||
Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | ||
| - | Result Predicted by | + | Result Predicted by [http://crdd.osdd.net/drugpedia/images/Rv02086.txt]<br> |
=External Links= | =External Links= | ||
Current revision
| Rv0208c
| |
| Name | |
| tRNA (guanine-N(7)-)-methyltransferase | |
| Identifiers | |
| Swiss Prot | |
| Genbank | |
| PDB | ? |
| Chemical data | |
| Formula | C16H15Cl2NO2 [1] |
| Mol. wt. | 28548 Da |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 9.8 |
Contents |
[edit] General
HYPOTHETICAL METHLYTRANSFERASE (METHYLASE) , intermediary metabolism and respiration, Essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003) mutants available at TARGET website
[edit] Protein Sequence
>Rv0208c, TB.seq 248116:248904 MW:28548 MVHHGQMHAQPGVGLRPDTPVASGQLPSTSIRSRRSGISKAQRETWERLWPELGLLALPQSPRGTPVDTRAWFGRDAPVV LEIGSGSGTSTLAMAKAEPHVDVIAVDVYRRGLAQLLCAIDKVGSDGINIRLILGNAVDVLQHLIAPDSLCGVRVFFPDP WPKARHHKRRLLQPATMALIADRLVPSGVLHAATDHPGYAEHIAAAGDAEPRLVRVDPDTELLPISVVRPATKYERKAQL GGGAVIELLWKKHGCSERDLKIR
[edit] Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|Q9UBP6.1 | 21 | 30 | 160 | 3e-04 |
| sp|Q9Y5R4.1 | 45 | 67 | 31 | 0.24 |
| sp|O95936.3 | 34 | 53 | 43 | 0.82 |
| sp|Q2MV58.2 | 24 | 52 | 57 | 2.0 |
| sp|Q9Y5S8.2 | 23 | 43 | 91 | 2.6 |
[edit] Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
Cytoplasmic
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by [2]
[edit] ABCpred Analysis
Link to ABCpred
Result Predicited by [3]
[edit] IEDB Analysis
Link to IEDB
Result Predicited by [4]
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result Predicited by [5]
[edit] IEDB Analysis
Link to IEDB
Result Predicted by [6]
[edit] MHC Class-II Binder
[edit] Propred Analysis
Link to Propred
Result Predicted by [7]
[edit] NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by [8]
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
