Immunotation of Rv0444c
From DrugPedia: A Wikipedia for Drug discovery
(→B cell Epitopes) |
(→Propred Analysis) |
||
| (3 intermediate revisions not shown.) | |||
| Line 78: | Line 78: | ||
Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | ||
<br> | <br> | ||
| - | Result Predicited by []<br> | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/QQ2.pdf]<br> |
| + | |||
==IEDB Analysis== | ==IEDB Analysis== | ||
Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | ||
| - | Result Predicted by [] | + | Result Predicted by [http://crdd.osdd.net/drugpedia/images/QQ1.pdf] |
=MHC Class-II Binder= | =MHC Class-II Binder= | ||
==Propred Analysis== | ==Propred Analysis== | ||
Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | ||
| - | Result Predicted by [] | + | Result Predicted by [http://crdd.osdd.net/drugpedia/images/QQ4.pdf] |
| - | + | ||
==NetMHC-II Analysis== | ==NetMHC-II Analysis== | ||
Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | ||
| - | Result Predicted by [] | + | Result Predicted by [http://crdd.osdd.net/drugpedia/images/QQ45.pdf] |
=External Links= | =External Links= | ||
Current revision
| Immunotation of Rv0444c
| |
| Name | |
| Anti-sigma-K factor rskA | |
| Identifiers | |
| Swiss Prot | |
| Genbank | |
| PDB | ? |
| Chemical data | |
| Formula | C28H37ClN4O6 [1] |
| Mol. wt. | 23883 Da |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | ? |
Contents |
[edit] General
The gene rv0444c in mycobacterium tuberculosis genome codes for protein named Anti-sigma-K factor rskA.The function of this protein is to represses sigK, the extracytoplasmic function (ECF) sigma factor K, by binding to it and inhibiting its activity. This leads to a decreased expression of sigK-regulated genes, such as mpt70 and mpt83.It has recently been advanced that Mycobacterium tuberculosis sigma factor K (SigK) positively regulates expression of the antigenic proteins MPB70 and MPB83.Analysis of in vitro mpt70/mpt83 expression and Rv0444c sequencing across M. tuberculosis complex (MTC) members revealed that high-level expression was associated with a mutated Rv0444c.
[edit] Protein Sequence
>Rv0444c, TB.seq 533092:533787 MW:23884 MTEHTDFELLELATPYALNAVSDDERADIDRRVAAAPSPVAAAFNDEVRAVRETMAVVSAATTAEPPAHLRTAILDATKP EVRRQSRWRTAAFASAAAIAVGLGAFGLGVLTRPSPPPTVAEQVLTAPDVRTVSRPLGAGTATVVFSRDRNTGLLVMNNV APPSRGTVYQMWLLGGAKGPRSAGTMGTAAVTPSTTATLTDLGASTALAFTVEPGTGSPQPTGTILAELPLG
[edit] Human Homologue Blast Result
Identities = 16/29 (55%), Positives = 18/29 (62%), Gaps = 0/29 (0%) Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Identities = 24/82 (29%), Positives = 35/82 (42%), Gaps = 9/82 (10%) Identities = 28/110 (25%), Positives = 44/110 (40%), Gaps = 9/110 (8%)
| subject ids | % identity | % positives | alignment length | evalue |
| sp|Q9UPX8 | 33 | 33 | 93 | 0.32 |
| sp|O14522 | 55 | 62 | 29 | 0.71 |
| sp|Q9BPW9 | 48 | 61 | 31 | 0.90 |
| sp|Q9UN74 | 29 | 42 | 82 | 1.8 |
| sp|P42226 | 25 | 40 | 110 | 2.0 |
[edit] Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
INTEGRAL MEMBRANE PROTEIN
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by [2]
[edit] ABCpred Analysis
Link to ABCpred
Result Predicited by [3]
[edit] IEDB Analysis
Link to IEDB
Result Predicited by [4]
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result Predicited by [5]
[edit] IEDB Analysis
Link to IEDB
Result Predicted by [6]
[edit] MHC Class-II Binder
[edit] Propred Analysis
Link to Propred
Result Predicted by [7]
[edit] NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by [8]
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
