Immunotation of Rv3596c
From DrugPedia: A Wikipedia for Drug discovery
(→Propred Analysis) |
|||
| (3 intermediate revisions not shown.) | |||
| Line 36: | Line 36: | ||
<td>subject ids</td><td>% identity</td><td>% positives</td><td>alignment length</td><td> evalue</td></tr> | <td>subject ids</td><td>% identity</td><td>% positives</td><td>alignment length</td><td> evalue</td></tr> | ||
| - | <tr><td></td><td> </td><td> </td><td> </td><td> </td></tr> | + | <tr><td>sp|Q9H078</td><td> 36</td><td> 58</td><td> 299</td><td> 2e-49</td></tr> |
| - | <tr><td></td><td> </td><td> </td><td> </td><td> </td></tr> | + | <tr><td>sp|Q8NB90</td><td> 24</td><td> 40</td><td> 377</td><td> 2e-04</td></tr> |
| - | <tr><td></td><td> </td><td> </td><td> </td><td> </td></tr> | + | <tr><td>sp|O14656</td><td> 24</td><td> 45</td><td> 189</td><td> 5e-04</td></tr> |
| - | <tr><td></td><td> </td><td> </td><td> </td><td> </td></tr> | + | <tr><td>sp|Q9BVQ7</td><td> 28</td><td> 45</td><td> 187</td><td> 0.001</td></tr> |
| - | <tr><td></td><td> </td><td> </td><td> </td><td> </td></tr></table> | + | <tr><td> sp|O14657</td><td> 27</td><td> 45</td><td> 182</td><td> 0.001</td></tr></table> |
=Alergen Protein= | =Alergen Protein= | ||
| Line 54: | Line 54: | ||
=Subcellular Location= | =Subcellular Location= | ||
Link to [http://www.imtech.res.in/raghava/tbpred/ TBpred]<br> | Link to [http://www.imtech.res.in/raghava/tbpred/ TBpred]<br> | ||
| - | + | CYTOPLASMIC PROTEIN | |
| - | + | ||
=Antigens= | =Antigens= | ||
No Hit Found in [http://www.imtech.res.in/raghava/antigendb/keyquery.html AntigenDB]<br> | No Hit Found in [http://www.imtech.res.in/raghava/antigendb/keyquery.html AntigenDB]<br> | ||
| Line 91: | Line 90: | ||
==NetMHC-II Analysis== | ==NetMHC-II Analysis== | ||
Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | ||
| - | Result Predicted by [] | + | Result Predicted by [http://crdd.osdd.net/drugpedia/index.php/Image:Ddddddd4.txt] |
=External Links= | =External Links= | ||
Current revision
| Immunotation of Rv3596c
| |
| Name | |
| <Rv3596c> ATP-dependent protease ATP-binding subunit ClpC1 | |
| Identifiers | |
| Swiss Prot | |
| Genbank | ? |
| PDB | |
| Chemical data | |
| Formula | ? |
| Mol. wt. | 93554 Da |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | ? |
Contents |
[edit] General
Rv3596c, (MTCY07H7B.26), clpC, len: 848. Probable atp-dependent clp protease atp-binding subunit, highly similar to members of the clpA/clpB family, e.g. MECB_BACSU P37571 negative regulator of genetic competence mecB (810 aa),fasta scores, opt: 2969, E(): 0, (61.2% identity in 811 aaoverlap); contains PS00017 ATP/GTP-binding site motif A. Updated info: Functional Category: intermediary metabolism and respiration. EC:3.4.-.-The ATP-dependent protease Clp plays important roles in the cell's protein quality control system and in the regulation of cellular processes. In Corynebacterium glutamicum, the levels of the proteolytic subunits ClpP1 and ClpP2 as well as of the corresponding mRNAs were drastically increased upon deletion of the clpC gene, coding for a Clp ATPase subunit. We identified a regulatory protein, designated ClgR, binding to a common palindromic sequence motif in front of clpP1P2 as well as of clpC. Deletion of clgR in the DeltaclpC background completely abolished the increased transcription of both operons,
[edit] Protein Sequence
>Rv3596c, TB.seq 4038158:4040701 MW:93554 MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLESLGISLEGVRSQVEEIIGQGQQAPSGHIPF TPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVAAQVLVKLGAELTRVRQQVIQLLSGYQGKEAAEAGTGGRGG ESGSPSTSLVLDQFGRNLTAAAMEGKLDPVIGREKEIERVMQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQAIVHGEVPE TLKDKQLYTLDLGSLVAGSRYRGDFEERLKKVLKEINTRGDIILFIDELHTLVGAGAAEGAIDAASILKPKLARGELQTI GATTLDEYRKYIEKDAALERRFQPVQVGEPTVEHTIEILKGLRDRYEAHHRVSITDAAMVAAATLADRYINDRFLPDKAI DLIDEAGARMRIRRMTAPPDLREFDEKIAEARREKESAIDAQDFEKAASLRDREKTLVAQRAEREKQWRSGDLDVVAEVD DEQIAEVLGNWTGIPVFKLTEAETTRLLRMEEELHKRIIGQEDAVKAVSKAIRRTRAGLKDPKRPSGSFIFAGPSGVGKT ELSKALANFLFGDDDALIQIDMGEFHDRFTASRLFGAPPGYVGYEEGGQLTEKVRRKPFSVVLFDEIEKAHQEIYNSLLQ VLEDGRLTDGQGRTVDFKNTVLIFTSNLGTSDISKPVGLGFSKGGGENDYERMKQKVNDELKKHFRPEFLNRIDDIIVFH QLTREEIIRMVDLMISRVAGQLKSKDMALVLTDAAKALLAKRGFDPVLGARPLRRTIQREIEDQLSEKILFEEVGPGQVV TVDVDNWDGEGPGEDAVFTFTGTRKPPAEPDLAKAGAHSAGGPEPAAR
[edit] Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|Q9H078 | 36 | 58 | 299 | 2e-49 |
| sp|Q8NB90 | 24 | 40 | 377 | 2e-04 |
| sp|O14656 | 24 | 45 | 189 | 5e-04 |
| sp|Q9BVQ7 | 28 | 45 | 187 | 0.001 |
| sp|O14657 | 27 | 45 | 182 | 0.001 |
[edit] Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
CYTOPLASMIC PROTEIN
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by Bcepred
[edit] ABCpred Analysis
Link to ABCpred
Result Predicited by ABCPred
[edit] IEDB Analysis
Link to IEDB
Result Predicited by IEDB
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result Predicited by [1]
[edit] IEDB Analysis
Link to IEDB
Result Predicted by [2]
[edit] MHC Class-II Binder
[edit] Propred Analysis
Link to Propred
Result Predicted by [3]
[edit] NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by [4]
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
