Immunotation of Rv3918c
From DrugPedia: A Wikipedia for Drug discovery
(→NetMHC-II Analysis) |
|||
| (One intermediate revision not shown.) | |||
| Line 42: | Line 42: | ||
Link to [http://www.imtech.res.in/raghava/algpred/ Algpred]<br> | Link to [http://www.imtech.res.in/raghava/algpred/ Algpred]<br> | ||
Non Allergen Predicted by AlgPred Server | Non Allergen Predicted by AlgPred Server | ||
| + | =Bacterial Toxin Prediction= | ||
| + | Link to [http://www.imtech.res.in/raghava/btxpred/submission.html btxpred]<br> | ||
| + | No Hit Fountd by btxpred server. | ||
| + | =Subcellular Location= | ||
| + | Link to [http://www.imtech.res.in/raghava/tbpred/ TBpred]<br> | ||
| + | integral membrane protein | ||
| + | =Antigens= | ||
| + | No Hit Found in [http://www.imtech.res.in/raghava/antigendb/keyquery.html AntigenDB]<br> | ||
| + | No. Hit Found in [http://www.iedb.org/ IEDB] | ||
| + | ==B cell Epitopes== | ||
| + | ====BCEpred Analysis==== | ||
| + | |||
| + | Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred] | ||
| + | <br> | ||
| + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Bcepred_rv2753.pdf Bcepred]<br> | ||
| + | |||
| + | ====ABCpred Analysis==== | ||
| + | Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br> | ||
| + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Abcpred_rv2753c.pdf ABCPred]<br> | ||
| + | |||
| + | ====IEDB Analysis==== | ||
| + | Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br> | ||
| + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/IEDB_rv2753c.pdf IEDB]<br> | ||
| + | =MHC Class-I Binder= | ||
| + | ==nHLAPred Analysis== | ||
| + | Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | ||
| + | <br> | ||
| + | Result Predicited by [http://crdd.osdd.net/drugpedia/index.php/Image:Bb1.txt]<br> | ||
| + | ==IEDB Analysis== | ||
| + | Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | ||
| + | Result Predicted by [http://crdd.osdd.net/drugpedia/index.php/Image:Bb2.txt] | ||
| + | |||
| + | =MHC Class-II Binder= | ||
| + | ==Propred Analysis== | ||
| + | Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | ||
| + | Result Predicted by [http://crdd.osdd.net/drugpedia/index.php/Image:Bb3.txt] | ||
| + | |||
| + | |||
| + | ==NetMHC-II Analysis== | ||
| + | Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | ||
| + | Result Predicted by [http://crdd.osdd.net/drugpedia/index.php/Image:Bb4.txt] | ||
| + | |||
| + | =External Links= | ||
| + | * [http://www.biohealthbase.org/mycobacterium Database] of ''Mycobacterium tuberculosis'' genome sequences and related information. | ||
| + | |||
| + | [[Category:C2D]] | ||
| + | [[Category:Mtb Immunotation]] | ||
Current revision
| Immunotation of Rv3918c
| |
| Name | |
| <Rv3918c> | |
| Identifiers | |
| Swiss Prot | |
| Genbank | ? |
| PDB | |
| Chemical data | |
| Formula | ? |
| Mol. wt. | 37516.7 |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 6.2621 |
Contents |
[edit] General
Rv3918c, (MTV028.09c), len: 347. Unknown, similar to TR:O05189(EMBL:U87804) CHROMOSOME PARTITIONING PROTEIN PARA from CAULOBACTER CRESCENTUS (266 aa), fasta scores; opt:787 z-score: 990.9 E(): 0, 50.6% identity in 261 aa overlapand to SOJ_BACSU P37522 soj protein. bacillus subtilis. 11/95 (253aa),fasta scores; opt: 837 z-score: 1062.3 E(): 0,52.2% identity in 251 aa overlap. Possible alternative startsite at aa 107. Also similar to other M. tuberculosis proteins MTCI125.30 (E(): 4.3e-32, 35.2% identity in 327 aa overlap) and MTCY07D11.13 (E(): 3e-30, 39.9% identity in 263aaoverlap). Updated info: Functional Category: cell wall and cell processes. EC:
[edit] Protein Sequence
>Rv3918c, TB.seq 4406488:4407528 MW:37518 VSAPWGPVAAGPSALVRSGQASTIEPFQREMTPPTPTPEAAHNPTMNVSRETSTEFDTPIGAAAERAMRVLHTTHEPLQR PGRRRVLTIANQKGGVGKTTTAVNIAAALAVQGLKTLVIDLDPQGNASTALGITDRQSGTPSSYEMLIGEVSLHTALRRS PHSERLFCIPATIDLAGAEIELVSMVARENRLRTALAALDNFDFDYVFVDCPPSLGLLTINALVAAPEVMIPIQCEYYAL EGVSQLMRNIEMVKAHLNPQLEVTTVILTMYDGRTKLADQVADEVRQYFGSKVLRTVIPRSVKVSEAPGYSMTIIDYDPG SRGAMSYLDASRELAERDRPPSAKGRP
[edit] Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|Q8TB37 | 27 | 42 | 280 | 5e-05 |
| sp|Q9Y5Y2 | 38 | 58 | 50 | 0.010 |
| sp|Q9H9Y4 | 25 | 35 | 129 | 0.34 |
| sp|Q8WXH0 | 26 | 44 | 99 | 0.99 |
| sp|Q5TAX3 | 41 | 50 | 34 | 1.5 |
[edit] Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
integral membrane protein
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by Bcepred
[edit] ABCpred Analysis
Link to ABCpred
Result Predicited by ABCPred
[edit] IEDB Analysis
Link to IEDB
Result Predicited by IEDB
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result Predicited by [1]
[edit] IEDB Analysis
Link to IEDB
Result Predicted by [2]
[edit] MHC Class-II Binder
[edit] Propred Analysis
Link to Propred
Result Predicted by [3]
[edit] NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by [4]
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
