Immunotation of Rv3921c

From DrugPedia: A Wikipedia for Drug discovery

(Difference between revisions)
Jump to: navigation, search
Current revision (06:54, 2 February 2010) (edit) (undo)
(General)
 
(3 intermediate revisions not shown.)
Line 14: Line 14:
}}
}}
=General=
=General=
 +
Rv3921c, (MTV028.12c), len: 366. Unknown membrane protein, equivalent to M. leprae TR:Q50205 (EMBL:L39923) L222-ORF13 (312 aa), fasta scores; opt: 1770 z-score: 2084.5 E(): 0, 88.2% identity in 288 aa overlap.The primary data source for this dataset was the full genome sequence of Mycobacterium tuberculosis strain H37Rv, derived from Genbank entry AL123456. This dataset was derived computationally using the PathoLogic program.
 +
==Protein Sequence==
==Protein Sequence==
>Rv3921c, TB.seq  4408969:4410066 MW:40885  
>Rv3921c, TB.seq  4408969:4410066 MW:40885  
Line 48: Line 50:
=Subcellular Location=
=Subcellular Location=
Link to [http://www.imtech.res.in/raghava/tbpred/ TBpred]<br>
Link to [http://www.imtech.res.in/raghava/tbpred/ TBpred]<br>
 +
INTEGRAL MEMBRANE PROTEIN

Current revision

Immunotation of Rv3921c
Name
<Rv3921c> conserved membrane protein
Identifiers
Swiss Prot P65626
Genbank  ?
PDB structure available No structure available
Chemical data
Formula  ?
Mol. wt. 40884.2
Pharmacokinetic data
Bioavailability  ?
Solubility  ?
Isoelectric-Point 10.6257

Contents

[edit] General

Rv3921c, (MTV028.12c), len: 366. Unknown membrane protein, equivalent to M. leprae TR:Q50205 (EMBL:L39923) L222-ORF13 (312 aa), fasta scores; opt: 1770 z-score: 2084.5 E(): 0, 88.2% identity in 288 aa overlap.The primary data source for this dataset was the full genome sequence of Mycobacterium tuberculosis strain H37Rv, derived from Genbank entry AL123456. This dataset was derived computationally using the PathoLogic program.


[edit] Protein Sequence

>Rv3921c, TB.seq 4408969:4410066 MW:40885 VSLLFDFFSLDFIYYPVSWIMWVWYRLFAFVLGPSNFFAWALSVMFLVFTLRALLYKPFVRQIRTTRQMQELQPQIKALQ KKYGKDRQRMALEMQKLQREHGFNPILGCLPMLAQIPVFLGLYHVLRSFNRTTGGFGQPHLSVIENRLTGNYVFSPVDVG HFLDANLFGAPIGAYMTQRSGLDAFVDFSRPALIAVGVPVMILAGIATYFNSRASIARQSAEAAANPQTAMMNKLALYVF PLGVVVGGPFLPLAIILYWFSNNIWTFGQQHYVFGMIEKEEEAKKQEAVRRRAANAPAPGAKPKRSPKTAPATNAAAPTE AGDTDDGAESDASTERPADTSNPARRNSGPSARTPRPGVRPKKRKR

[edit] Human Homologue Blast Result

subject ids% identity% positivesalignment length evalue
sp|Q70CQ4 31 53 63 0.43
sp|Q7RTS5 32 40 64 0.72
sp|P08240 33 50 57 0.81
sp|Q14202 26 43 87 0.84
sp|Q8N954 26 47 82 0.92

[edit] Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

[edit] Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

[edit] Subcellular Location

Link to TBpred
INTEGRAL MEMBRANE PROTEIN


[edit] Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

[edit] B cell Epitopes

[edit] BCEpred Analysis

Link to Bcepred
Result Predicited by Bcepred

[edit] ABCpred Analysis

Link to ABCpred
Result Predicited by ABCPred

[edit] IEDB Analysis

Link to IEDB
Result Predicited by IEDB

[edit] MHC Class-I Binder

[edit] nHLAPred Analysis

Link to nHLApred
Result Predicited by [1]

[edit] IEDB Analysis

Link to IEDB
Result Predicted by [2]

[edit] MHC Class-II Binder

[edit] Propred Analysis

Link to Propred
Result Predicted by [3]


[edit] NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by [4]

[edit] External Links

  • Database of Mycobacterium tuberculosis genome sequences and related information.