Immunotation of Rv3340
From DrugPedia: A Wikipedia for Drug discovery
(→General) |
(→MHC Class-II Binder) |
||
| (6 intermediate revisions not shown.) | |||
| Line 38: | Line 38: | ||
<td>subject ids</td><td>% identity</td><td>% positives</td><td>alignment length</td><td> evalue</td></tr> | <td>subject ids</td><td>% identity</td><td>% positives</td><td>alignment length</td><td> evalue</td></tr> | ||
| - | <tr><td></td><td> </td><td> </td><td> </td><td> </td></tr> | + | <tr><td>sp|P32929</td><td> 34</td><td> 52</td><td> 403</td><td> 8e-55</td></tr> |
| - | <tr><td></td><td> </td><td> </td><td> </td><td> </td></tr> | + | <tr><td>sp|Q9UJX2</td><td> 23</td><td> 42</td><td> 94</td><td> 1.2</td></tr> |
| - | <tr><td></td><td> </td><td> </td><td> </td><td> </td></tr> | + | <tr><td>sp|Q5VU43</td><td> 35</td><td> 50</td><td> 62</td><td> 2.8 </td></tr> |
| - | <tr><td></td><td> </td><td> </td><td> </td><td> | + | <tr><td>sp|Q9NYC9</td><td> 30</td><td> 47</td><td> 71</td><td> 4.2</td></tr></table> |
| - | + | ||
| - | + | ||
=Alergen Protein= | =Alergen Protein= | ||
Link to [http://www.imtech.res.in/raghava/algpred/ Algpred]<br> | Link to [http://www.imtech.res.in/raghava/algpred/ Algpred]<br> | ||
| - | + | Allergen Predicted by AlgPred Server | |
=Bacterial Toxin Prediction= | =Bacterial Toxin Prediction= | ||
Link to [http://www.imtech.res.in/raghava/btxpred/submission.html btxpred]<br> | Link to [http://www.imtech.res.in/raghava/btxpred/submission.html btxpred]<br> | ||
| Line 56: | Line 54: | ||
=Subcellular Location= | =Subcellular Location= | ||
Link to [http://www.imtech.res.in/raghava/tbpred/ TBpred]<br> | Link to [http://www.imtech.res.in/raghava/tbpred/ TBpred]<br> | ||
| - | + | Integral Membrane Protein | |
=Antigens= | =Antigens= | ||
| Line 66: | Line 64: | ||
Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred] | Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred] | ||
<br> | <br> | ||
| - | Result Predicited by []<br> | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/A111.pdf]<br> |
====ABCpred Analysis==== | ====ABCpred Analysis==== | ||
Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br> | Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br> | ||
| - | Result Predicited by []<br> | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/A222.pdf]<br> |
====IEDB Analysis==== | ====IEDB Analysis==== | ||
Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br> | Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br> | ||
| - | Result Predicited by []<br> | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/A333.pdf]<br> |
=MHC Class-I Binder= | =MHC Class-I Binder= | ||
| Line 80: | Line 78: | ||
Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | ||
<br> | <br> | ||
| - | Result Predicited by []<br> | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/C11.pdf]<br> |
==IEDB Analysis== | ==IEDB Analysis== | ||
Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | ||
| - | Result Predicted by [] | + | Result Predicted by [http://crdd.osdd.net/drugpedia/images/D1.txt] |
=MHC Class-II Binder= | =MHC Class-II Binder= | ||
==Propred Analysis== | ==Propred Analysis== | ||
Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | ||
| - | Result Predicted by [] | + | Result Predicted by [http://crdd.osdd.net/drugpedia/images/F1.pdf] |
==NetMHC-II Analysis== | ==NetMHC-II Analysis== | ||
Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | ||
| - | Result Predicted by [] | + | Result Predicted by [http://crdd.osdd.net/drugpedia/images/E1.txt] |
=External Links= | =External Links= | ||
Current revision
| Immunotation of Rv3340
| |
| Name | |
| O-acetylhomoserineaminocarboxypropyltransferase | |
| Identifiers | |
| Swiss Prot | |
| Genbank | |
| PDB | ? |
| Chemical data | |
| Formula | [] |
| Mol. wt. | 47370.6 Da |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 5.19 |
Contents |
[edit] General
In enzymology, an O-acetylhomoserine aminocarboxypropyltransferase is an enzyme that catalyzes the chemical reaction
O-acetyl-L-homoserine + methanethiol --- L-methionine + acetate
Thus, the two substrates of this enzyme are O-acetyl-L-homoserine and methanethiol, whereas its two products are L-methionine and acetate.
This enzyme belongs to the family of transferases, specifically those transferring aryl or alkyl groups other than methyl groups. The systematic name of this enzyme class is O-acetyl-L-homoserine:methanethiol 3-amino-3-carboxypropyltransferase. Other names in common use include O-acetyl-L-homoserine acetate-lyase (adding methanethiol), O-acetyl-L-homoserine sulfhydrolase, O-acetylhomoserine (thiol)-lyase, O-acetylhomoserine sulfhydrolase, and methionine synthase. This enzyme participates in methionine metabolism and cysteine metabolism.
[edit] Protein Sequence
>Rv3340, TB.seq 3726123:3727469 MW:47372 MSADSNSTDADPTAHWSFETKQIHAGQHPDPTTNARALPIYATTSYTFDDTAHAAALFGLEIPGNIYTRIGNPTTDVVEQ RIAALEGGVAALFLSSGQAAETFAILNLAGAGDHIVSSPRLYGGTYNLFHYSLAKLGIEVSFVDDPDDLDTWQAAVRPNT KAFFAETISNPQIDLLDTPAVSEVAHRNGVPLIVDNTIATPYLIQPLAQGADIVVHSATKYLGGHGAAIAGVIVDGGNFD WTQGRFPGFTTPDPSYHGVVFAELGPPAFALKARVQLLRDYGSAASPFNAFLVAQGLETLSLRIERHVANAQRVAEFLAA RDDVLSVNYAGLPSSPWHERAKRLAPKGTGAVLSFELAGGIEAGKAFVNALKLHSHVANIGDVRSLVIHPASTTHAQLSP AEQLATGVSPGLVRLAVGIEGIDDILADLELGFAAARRFSADPQSVAAF
[edit] Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|P32929 | 34 | 52 | 403 | 8e-55 |
| sp|Q9UJX2 | 23 | 42 | 94 | 1.2 |
| sp|Q5VU43 | 35 | 50 | 62 | 2.8 |
| sp|Q9NYC9 | 30 | 47 | 71 | 4.2 |
[edit] Alergen Protein
Link to Algpred
Allergen Predicted by AlgPred Server
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
Integral Membrane Protein
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by [1]
[edit] ABCpred Analysis
Link to ABCpred
Result Predicited by [2]
[edit] IEDB Analysis
Link to IEDB
Result Predicited by [3]
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result Predicited by [4]
[edit] IEDB Analysis
Link to IEDB
Result Predicted by [5]
[edit] MHC Class-II Binder
[edit] Propred Analysis
Link to Propred
Result Predicted by [6]
[edit] NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by [7]
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.
