Immunotation of Rv2753c (dihydrodipicolinate synthase)
From DrugPedia: A Wikipedia for Drug discovery
(→MHC Class-I Binder) |
|||
(3 intermediate revisions not shown.) | |||
Line 60: | Line 60: | ||
Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred] | Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred] | ||
<br> | <br> | ||
- | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Bcepred_rv2753.pdf | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Bcepred_rv2753.pdf Bcepred]<br> |
====ABCpred Analysis==== | ====ABCpred Analysis==== | ||
Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br> | Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br> | ||
- | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Abcpred_rv2753c.pdf | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Abcpred_rv2753c.pdf ABCPred]<br> |
====IEDB Analysis==== | ====IEDB Analysis==== | ||
- | + | Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br> | |
- | Result Predicited by [http://crdd.osdd.net/drugpedia/images/IEDB_rv2753c.pdf | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/IEDB_rv2753c.pdf IEDB]<br> |
=MHC Class-I Binder= | =MHC Class-I Binder= | ||
Line 74: | Line 74: | ||
Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | ||
<br> | <br> | ||
- | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Nhlapred_rv2753c.pdf | + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Nhlapred_rv2753c.pdf nHLApred]<br> |
==IEDB Analysis== | ==IEDB Analysis== | ||
Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> |
Current revision
Immunotation of Rv2753c (dihydrodipicolinate synthase)
| |
Name | |
Dihydrodipicolinate Synthase | |
Identifiers | |
Swiss Prot | |
Genbank | |
PDB | |
Chemical data | |
Formula | C28H37ClN4O6 [1] |
Mol. wt. | 30,858 Da |
Pharmacokinetic data | |
Bioavailability | ? |
Solubility | ? |
Isoelectric-Point | 5.57 |
Contents |
[edit] General
dapA catalyzes the formation of dihydrodipicolinate from L-aspartate 4-semialdehyde and pyruvate.
L-aspartate 4-semialdehyde + pyruvate = dihydrodipicolinate + 2H2O.
This protein is eesential for optimal growth of M.tb and found in the cytoplasm as predicted by the TBpred. HMMpfam found one domain PF00701 and has Helix Turn Helix secondary structure.
[edit] Protein Sequence
>Rv2753c, TB.seq 3066222:3067121 MW:30827 VTTVGFDVAARLGTLLTAMVTPFSGDGSLDTATAARLANHLVDQGCDGLVVSGTTGESPTTTDGEKIELLRAVLEAVGDR ARVIAGAGTYDTAHSIRLAKACAAEGAHGLLVVTPYYSKPPQRGLQAHFTAVADATELPMLLYDIPGRSAVPIEPDTIRA LASHPNIVGVKDAKADLHSGAQIMADTGLAYYSGDDALNLPWLAMGATGFISVIAHLAAGQLRELLSAFGSGDIATARKI NIAVAPLCNAMSRLGGVTLSKAGLRLQGIDVGDPRLPQVAATPEQIDALAADMRAASVLR
[edit] Human Homologue Blast Result
subject ids | % identity | % positives | alignment length | evalue |
sp|Q9BXD5 | 28 | 46.33 | 300 | 3.00E-023 |
sp|Q86XE5 | 26.57 | 46.15 | 286 | 4.00E-022 |
sp|Q9UG63 | 26.49 | 37.75 | 151 | 0.45 |
sp|O14556 | 22.09 | 50 | 86 | 2 |
sp|Q7Z7B0 | 27.69 | 44.62 | 65 | 2.7 |
[edit] Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
Cyoplasmic
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by Bcepred
[edit] ABCpred Analysis
Link to ABCpred
Result Predicited by ABCPred
[edit] IEDB Analysis
Link to IEDB
Result Predicited by IEDB
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result Predicited by nHLApred
[edit] IEDB Analysis
Link to IEDB
Result Predicted by IEDB
[edit] MHC Class-II Binder
[edit] Propred Analysis
Link to Propred
Result Predicted by Propred
[edit] NetMHC-II Analysis
Link to NetMHC-II
Result Predicted by NetMHC-II
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.