From DrugPedia: A Wikipedia for Drug discovery

(Difference between revisions)

Current revision

Immunotation of Rv2753c (dihydrodipicolinate synthase)
Name
Dihydrodipicolinate Synthase
Identifiers
Swiss Prot	P63945
Genbank	888289
PDB	1XXX
Chemical data
Formula	C28H37ClN4O6 [1]
Mol. wt.	30,858 Da
Pharmacokinetic data
Bioavailability	?
Solubility	?
Isoelectric-Point	5.57

1 General
- 1.1 Protein Sequence
2 Human Homologue Blast Result
3 Alergen Protein
4 Bacterial Toxin Prediction
5 Subcellular Location
6 Antigens
- 6.1 B cell Epitopes
7 MHC Class-I Binder
- 7.1 nHLAPred Analysis
- 7.2 IEDB Analysis
8 MHC Class-II Binder
- 8.1 Propred Analysis
- 8.2 NetMHC-II Analysis
9 External Links

[edit] General

dapA catalyzes the formation of dihydrodipicolinate from L-aspartate 4-semialdehyde and pyruvate.

L-aspartate 4-semialdehyde + pyruvate = dihydrodipicolinate + 2H₂O.

This protein is eesential for optimal growth of M.tb and found in the cytoplasm as predicted by the TBpred. HMMpfam found one domain PF00701 and has Helix Turn Helix secondary structure.

[edit] Protein Sequence

>Rv2753c, TB.seq 3066222:3067121 MW:30827 VTTVGFDVAARLGTLLTAMVTPFSGDGSLDTATAARLANHLVDQGCDGLVVSGTTGESPTTTDGEKIELLRAVLEAVGDR ARVIAGAGTYDTAHSIRLAKACAAEGAHGLLVVTPYYSKPPQRGLQAHFTAVADATELPMLLYDIPGRSAVPIEPDTIRA LASHPNIVGVKDAKADLHSGAQIMADTGLAYYSGDDALNLPWLAMGATGFISVIAHLAAGQLRELLSAFGSGDIATARKI NIAVAPLCNAMSRLGGVTLSKAGLRLQGIDVGDPRLPQVAATPEQIDALAADMRAASVLR

[edit] Human Homologue Blast Result

subject ids	% identity	% positives	alignment length	evalue
sp\|Q9BXD5	28	46.33	300	3.00E-023
sp\|Q86XE5	26.57	46.15	286	4.00E-022
sp\|Q9UG63	26.49	37.75	151	0.45
sp\|O14556	22.09	50	86	2
sp\|Q7Z7B0	27.69	44.62	65	2.7

[edit] Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

[edit] Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

[edit] Subcellular Location

Link to TBpred
Cyoplasmic

[edit] Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

[edit] B cell Epitopes

[edit] BCEpred Analysis

Link to Bcepred
Result Predicited by Bcepred

[edit] ABCpred Analysis

Link to ABCpred
Result Predicited by ABCPred

[edit] IEDB Analysis

Link to IEDB
Result Predicited by IEDB

[edit] MHC Class-I Binder

[edit] nHLAPred Analysis

Link to nHLApred
Result Predicited by nHLApred

[edit] IEDB Analysis

Link to IEDB
Result Predicted by IEDB

[edit] MHC Class-II Binder

[edit] Propred Analysis

Link to Propred
Result Predicted by Propred

[edit] NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by NetMHC-II

[edit] External Links

Database of Mycobacterium tuberculosis genome sequences and related information.

@@ Line 8: / Line 8: @@
 | PDB         = 1XXX
 | DrugBank          =
-| chemical_formula  =
+| chemical_formula  = C28H37ClN4O6 [http://pubchem.ncbi.nlm.nih.gov/summary/summary.cgi?cid=18062777&loc=ec_rcs#Properties]
 | molecular_weight  = 30,858 Da
 | solubility        =
@@ Line 18: / Line 18: @@
 L-aspartate 4-semialdehyde + pyruvate = dihydrodipicolinate + 2H<sub>2</sub>O.
-This protein is eesential for optimal growth of M.tb and found in the cytoplasm as predicted by the [http://wolfpsort.org/aboutWoLF_PSORT.html.en WoLFPSORT] and [http://www.biohealthbase.org/brc/localizationPrograms.do?decorator=mycobacterium  Subloc] Server. HMMpfam found one domain PF00701 and has Helix Turn Helix secondary structure.
+This protein is eesential for optimal growth of M.tb and found in the cytoplasm as predicted by the [http://www.imtech.res.in/raghava/tbpred/ TBpred]. HMMpfam found one domain PF00701 and has Helix Turn Helix secondary structure.
+==Protein Sequence==
+>Rv2753c, TB.seq  3066222:3067121 MW:30827
+VTTVGFDVAARLGTLLTAMVTPFSGDGSLDTATAARLANHLVDQGCDGLVVSGTTGESPTTTDGEKIELLRAVLEAVGDR
+ARVIAGAGTYDTAHSIRLAKACAAEGAHGLLVVTPYYSKPPQRGLQAHFTAVADATELPMLLYDIPGRSAVPIEPDTIRA
+LASHPNIVGVKDAKADLHSGAQIMADTGLAYYSGDDALNLPWLAMGATGFISVIAHLAAGQLRELLSAFGSGDIATARKI
+NIAVAPLCNAMSRLGGVTLSKAGLRLQGIDVGDPRLPQVAATPEQIDALAADMRAASVLR
 =Human Homologue Blast Result=
@@ Line 34: / Line 41: @@
 <tr><td>sp|Q7Z7B0</td><td>	27.69</td><td>	44.62</td><td>	65</td><td>	2.7</td></tr></table>
-=Antigens=
-=Haptens=
-=Epitopes=
-===B-Cell Epitopes===
-<table border='1'>
-<tr><td>PFSGDGSLDTA
-</td></tr><tr><td>
-GTTGESPTTTDGE
-</td></tr><tr><td>
-GTYDTAH
-</td></tr><tr><td>
-AEG
-</td></tr><tr><td>
-YSKPPQRGLQ
-</td></tr><tr><td>
-DATEL
-</td></tr><tr><td>
-RSAVPIEPDTIRA
-</td></tr><tr><td>
-KADLHSG
-</td></tr><tr><td>
-YSGDDALN
-</td></tr><tr><td>
-IATAR
-</td></tr><tr><td>
-GDPRLPQVAATPEQIDALAAD
-</td></tr><table>
-===MHC class I restricted T cell epitopes===
-===CTL Epitopes===
-=MHC Binder=
-===Class-I Binder===
-<table border='1'><tr><td>
-Epitope</td><td>No of Alleles
-</td></tr><tr><td>
-VPIEPDTIR </td><td>      15
-</td></tr><tr><td>
-TPFSGDGSL </td><td>      14
-</td></tr><tr><td>
-TLSKAGLRL </td><td>      13
-</td></tr><tr><td>
-IEPDTIRAL </td><td>      13
-</td></tr><tr><td>
-GTYDTAHSI </td><td>      13
-</td></tr><tr><td>
-DDALNLPWL </td><td>      11
-</td></tr><tr><td>
-GFISVIAHL  </td><td>     10
-</td></tr><tr><td>
-GATGFISVI </td><td>      10
-</td></tr><tr><td>
-ATPEQIDAL </td><td>      10
-</td></tr><tr><td>
-YDTAHSIRL </td><td>      9
-</td></tr><tr><td>
-GDIATARKI  </td><td>     9
-</td></tr><tr><td>
-AVLEAVGDR  </td><td>     9
-</td></tr><tr><td>
-ASHPNIVGV  </td><td>     9
-</td></tr><tr><td>
-QRGLQAHFT  </td><td>     7
-</td></tr><tr><td>
-GLQAHFTAV  </td><td>     7
-</td></tr><tr><td>
-AVGDRARVI  </td><td>     7
-</td></tr><tr><td>
-YSGDDALNL  </td><td>     6
-</td></tr><tr><td>
-VGFDVAARL  </td><td>     6
-</td></tr><tr><td>
-QLRELLSAF </td><td>      6
-</td></tr><tr><td>
-TAVADATEL </td><td>      5
-</td></tr><tr><td>
-TAARLANHL  </td><td>     5
-</td></tr><tr><td>
-LLRAVLEAV  </td><td>     5
-</td></tr><tr><td>
-GEKIELLRA  </td><td>     5
-</td></tr><tr><td>
-DTATAARLA  </td><td>     5
-</td></tr><tr><td>
-AAGQLRELL  </td><td>     5
-</td></tr><tr><td>
-TDGEKIELL  </td><td>     4
-</td></tr><tr><td>
-QAHFTAVAD  </td><td>     4
-</td></tr><tr><td>
-MSRLGGVTL  </td><td>     4
-</td></tr><tr><td>
-LDTATAARL   </td><td>    4
-</td></tr><tr><td>
-HPNIVGVKD   </td><td>    4
-</td></tr><tr><td>
-GVKDAKADL   </td><td>    4
-</td></tr><tr><td>
-DGEKIELLR  </td><td>     4
-</td></tr><tr><td>
-KIELLRAVL </td><td>      3
-</td></tr><tr><td>
-HSIRLAKAC  </td><td>     3
-</td></tr><tr><td>
-GSGDIATAR  </td><td>     3
-</td></tr><tr><td>
-AHLAAGQLR  </td><td>     3
-</td></tr><tr><td>
-PTTTDGEKI  </td><td>     2
-</td></tr><tr><td>
-IAHLAAGQL </td><td>      2
-</td></tr><tr><td>
-DLHSGAQIM  </td><td>     2
-</td></tr><tr><td>
-===Class-II Binder===
 =Alergen Protein=
+Link to [http://www.imtech.res.in/raghava/algpred/ Algpred]<br>
 Non Allergen Predicted by AlgPred Server
-=Antibacterial=
+=Bacterial Toxin Prediction=
-=Bacterial Toxin=
+Link to [http://www.imtech.res.in/raghava/btxpred/submission.html btxpred]<br>
+No Hit Fountd by btxpred server.
+=Subcellular Location=
+Link to [http://www.imtech.res.in/raghava/tbpred/ TBpred]<br>
+Cyoplasmic
+=Antigens=
+No Hit Found in [http://www.imtech.res.in/raghava/antigendb/keyquery.html AntigenDB]<br>
+No. Hit Found in [http://www.iedb.org/ IEDB]
+==B cell Epitopes==
+====BCEpred Analysis====
+Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred]
+<br>
+Result Predicited by  [http://crdd.osdd.net/drugpedia/images/Bcepred_rv2753.pdf Bcepred]<br>
+====ABCpred Analysis====
+Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br>
+Result Predicited by  [http://crdd.osdd.net/drugpedia/images/Abcpred_rv2753c.pdf ABCPred]<br>
+====IEDB Analysis====
+Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br>
+Result Predicited by  [http://crdd.osdd.net/drugpedia/images/IEDB_rv2753c.pdf IEDB]<br>
+=MHC Class-I Binder=
+==nHLAPred Analysis==
+Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred]
+<br>
+Result Predicited by  [http://crdd.osdd.net/drugpedia/images/Nhlapred_rv2753c.pdf nHLApred]<br>
+==IEDB Analysis==
+Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br>
+Result Predicted by [http://crdd.osdd.net/drugpedia/images/IEDB_mhc_rv2753c.pdf IEDB]
+=MHC Class-II Binder=
+==Propred Analysis==
+Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br>
+Result Predicted by [http://crdd.osdd.net/drugpedia/images/Propred_rv2753c.pdf Propred]
+==NetMHC-II Analysis==
+Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br>
+Result Predicted by [http://crdd.osdd.net/drugpedia/images/NetMHC-II_rv2753c.pdf NetMHC-II]
 =External Links=
+* [http://www.biohealthbase.org/mycobacterium Database] of ''Mycobacterium tuberculosis'' genome sequences and related information.
 [[Category:C2D]]
 [[Category:Mtb Immunotation]]

Immunotation of Rv2753c (dihydrodipicolinate synthase)

From DrugPedia: A Wikipedia for Drug discovery

Current revision

Contents

[edit] General

[edit] Protein Sequence

[edit] Human Homologue Blast Result

[edit] Alergen Protein

[edit] Bacterial Toxin Prediction

[edit] Subcellular Location

[edit] Antigens

[edit] B cell Epitopes

[edit] BCEpred Analysis

[edit] ABCpred Analysis

[edit] IEDB Analysis

[edit] MHC Class-I Binder

[edit] nHLAPred Analysis

[edit] IEDB Analysis

[edit] MHC Class-II Binder

[edit] Propred Analysis

[edit] NetMHC-II Analysis

[edit] External Links

Views

Personal tools

Search

Navigation

Toolbox