Immunotation of Rv0260c
From DrugPedia: A Wikipedia for Drug discovery
(New page: {{immunebox | Name =<b> PPOSIBLE TRANSCRIPTIONAL REGULATORY PROTEIN </b> |image= | width=250 |image2= |Swiss Prot = P95217 | Genbank =923195[http://www.ncbi.nlm.nih.gov/si...) |
|||
(One intermediate revision not shown.) | |||
Line 20: | Line 20: | ||
==Protein Sequence== | ==Protein Sequence== | ||
>Rv0260c, TB.seq 311515:312657 MW:40734 | >Rv0260c, TB.seq 311515:312657 MW:40734 | ||
+ | |||
+ | |||
+ | |||
MAQAHSAPLTGYRIAVTSARRAEELCALLRRQGAEVCSAPAIKMIALPDDDELQNNTEALIADPPDILVAHTGIGFRGWL | MAQAHSAPLTGYRIAVTSARRAEELCALLRRQGAEVCSAPAIKMIALPDDDELQNNTEALIADPPDILVAHTGIGFRGWL | ||
AAAEGWGLANELLESLSSARIISRGPKATGALRAAGLREEWSPDSESSHEVLEYLLESGVSRTRIAVQLHGAADSWDPFP | AAAEGWGLANELLESLSSARIISRGPKATGALRAAGLREEWSPDSESSHEVLEYLLESGVSRTRIAVQLHGAADSWDPFP | ||
Line 62: | Line 65: | ||
Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br> | Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br> | ||
Result Predicited by [http://crdd.osdd.net/drugpedia/index.php/Image:ABCpred_Prediction_Server0260c.doc] | Result Predicited by [http://crdd.osdd.net/drugpedia/index.php/Image:ABCpred_Prediction_Server0260c.doc] | ||
+ | |||
+ | |||
=MHC Class-I Binder= | =MHC Class-I Binder= | ||
==nHLAPred Analysis== | ==nHLAPred Analysis== | ||
Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | ||
<br> | <br> | ||
- | Result predicted by [] | + | Result predicted by [http://crdd.osdd.net/drugpedia/index.php/Image:NHLAPred0260c.doc] |
+ | |||
+ | ==IEDB Analysis== | ||
+ | Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | ||
+ | Results[http://crdd.osdd.net/drugpedia/index.php/Image:IEDB0260c.doc] | ||
+ | |||
+ | =MHC Class-II Binder= | ||
+ | ==Propred Analysis== | ||
+ | Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | ||
+ | Results[http://crdd.osdd.net/drugpedia/index.php/Image:MHC_ClassIIprophed0260c.doc] | ||
+ | |||
+ | ==NetMHC-II Analysis== | ||
+ | Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | ||
+ | Results[http://crdd.osdd.net/drugpedia/index.php/Image:NetMHCII-0260c.doc] | ||
+ | |||
+ | =External Links= | ||
+ | * [http://www.biohealthbase.org/mycobacterium Database] of ''Mycobacterium tuberculosis'' genome sequences and related information. | ||
+ | |||
+ | [[Category:C2D]] | ||
+ | [[Category:Mtb Immunotation]] |
Current revision
Immunotation of Rv0260c
| |
Name | |
PPOSIBLE TRANSCRIPTIONAL REGULATORY PROTEIN | |
Identifiers | |
Swiss Prot | |
Genbank | |
PDB | ? |
Chemical data | |
Formula | ? |
Mol. wt. | 40732.6 Da |
Pharmacokinetic data | |
Bioavailability | ? |
Solubility | ? |
Isoelectric-Point | 7.1122 |
Contents |
[edit] General
non essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003) Rv0260c, (MTCY0A4.04c), len: 381 aa. Possible two-component response regulator, highly similar to CAB72204.1|AL138851 putative transcriptional regulator from Streptomyces coelicolor (395 aa); and similar to O34394|D69851|YJJA conserved hypothetical protein from Bacillus subtilis (270 aa), FASTA scores: opt: 312, E(): 7.4e-14, (25.8% identity in 267 aa overlap). Also some similarity to regulatory proteins at C-terminal region e.g. CUTR_STRLI|Q03756 transcriptional regulatory protein (217 aa), FASTA scores: opt: 138, E(): 0.02, (30.6% identity in 111 aa overlap).
[edit] Protein Sequence
>Rv0260c, TB.seq 311515:312657 MW:40734
MAQAHSAPLTGYRIAVTSARRAEELCALLRRQGAEVCSAPAIKMIALPDDDELQNNTEALIADPPDILVAHTGIGFRGWL AAAEGWGLANELLESLSSARIISRGPKATGALRAAGLREEWSPDSESSHEVLEYLLESGVSRTRIAVQLHGAADSWDPFP EFLGGLRFAGAQVVPIRVYRWKPAPLGGVFDHLVTGIARRQFDAVTFTSAPAAAAVLERSRELDIEDQLLAALRTDVHAM CVGPVTSRPLIRKGVPTSAPERMRLGALARHIAEELPLLGSCTFKAAGHVIEIRGTSVLVDDSVKPLSPSGMAILRALVH RPGGVVSRGDLLRVLPGDGSDTHAVDTAVLRLRTALGDKNIVATVVKRGYRLAVDSRHDDV
[edit] Human Homologue Blast Result
subject ids | % identity | % positives | alignment length | evalue |
sp|Q9Y4B6.3 | 23 | 37 | 105 | 7.4 |
[edit] Alergen Protein
Link to Algpred
Non Allergen
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
Cytoplasmic Protein
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by [2]
[edit] ABCpred Analysis
Link to ABCpred
Result Predicited by[3]
[edit] IEDB Analysis
Link to IEDB
Result Predicited by [4]
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result predicted by [5]
[edit] IEDB Analysis
[edit] MHC Class-II Binder
[edit] Propred Analysis
[edit] NetMHC-II Analysis
[edit] External Links
- Database of Mycobacterium tuberculosis genome sequences and related information.