Immunotation of Rv0444c

From DrugPedia: A Wikipedia for Drug discovery

(Difference between revisions)
Jump to: navigation, search
(New page: {{immunebox | Name =<b>Anti-sigma-K factor rskA</b> |image= | width=250 |image2= |Swiss Prot = O53729 | Genbank = 886346 | PDB = | DrugBank = | chemical...)
Current revision (08:49, 18 February 2010) (edit) (undo)
(→Propred Analysis)
 
(6 intermediate revisions not shown.)
Line 25: Line 25:
=Human Homologue Blast Result=
=Human Homologue Blast Result=
 +
Identities = 16/29 (55%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 +
Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%)
 +
Identities = 24/82 (29%), Positives = 35/82 (42%), Gaps = 9/82 (10%)
 +
Identities = 28/110 (25%), Positives = 44/110 (40%), Gaps = 9/110 (8%)
 +
 +
<table border='1'><tr>
<table border='1'><tr>
Line 30: Line 36:
<td>subject ids</td><td>% identity</td><td>% positives</td><td>alignment length</td><td> evalue</td></tr>
<td>subject ids</td><td>% identity</td><td>% positives</td><td>alignment length</td><td> evalue</td></tr>
-
<tr><td></td><td> </td><td> </td><td> </td><td> </td></tr>
+
<tr><td>sp|Q9UPX8</td><td> 33</td><td> 33</td><td> 93</td><td> 0.32</td></tr>
-
<tr><td></td><td> </td><td> </td><td> </td><td> </td></tr>
+
<tr><td>sp|O14522</td><td> 55</td><td> 62</td><td> 29</td><td> 0.71</td></tr>
-
<tr><td></td><td> </td><td> </td><td> </td><td> </td></tr>
+
<tr><td>sp|Q9BPW9</td><td> 48</td><td> 61</td><td> 31</td><td> 0.90</td></tr>
-
<tr><td></td><td> </td><td> </td><td> </td><td> </td></tr>
+
<tr><td>sp|Q9UN74</td><td> 29</td><td> 42</td><td> 82</td><td> 1.8 </td></tr>
-
<tr><td></td><td> </td><td> </td><td> </td><td></td></tr></table>
+
<tr><td>sp|P42226</td><td> 25</td><td> 40</td><td> 110</td><td>       2.0</td></tr></table>
=Alergen Protein=
=Alergen Protein=
Line 48: Line 54:
=Subcellular Location=
=Subcellular Location=
Link to [http://www.imtech.res.in/raghava/tbpred/ TBpred]<br>
Link to [http://www.imtech.res.in/raghava/tbpred/ TBpred]<br>
-
Cyoplasmic
+
INTEGRAL MEMBRANE PROTEIN
=Antigens=
=Antigens=
Line 58: Line 64:
Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred]   
Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred]   
<br>
<br>
-
Result Predicited by  []<br>
+
Result Predicited by  [http://crdd.osdd.net/drugpedia/images/Q1.pdf]<br>
====ABCpred Analysis====
====ABCpred Analysis====
Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br>
Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br>
-
Result Predicited by  []<br>
+
Result Predicited by  [http://crdd.osdd.net/drugpedia/images/Q2.pdf]<br>
====IEDB Analysis====
====IEDB Analysis====
Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br>
Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br>
-
Result Predicited by  [B]<br>
+
Result Predicited by  [http://crdd.osdd.net/drugpedia/images/Q3.pdf]<br>
=MHC Class-I Binder=
=MHC Class-I Binder=
Line 72: Line 78:
Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred]
Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred]
<br>  
<br>  
-
Result Predicited by  []<br>
+
Result Predicited by  [http://crdd.osdd.net/drugpedia/images/QQ2.pdf]<br>
 +
 
==IEDB Analysis==
==IEDB Analysis==
Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br>
Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br>
-
Result Predicted by []
+
Result Predicted by [http://crdd.osdd.net/drugpedia/images/QQ1.pdf]
=MHC Class-II Binder=
=MHC Class-II Binder=
==Propred Analysis==
==Propred Analysis==
Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br>
Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br>
-
Result Predicted by []
+
Result Predicted by [http://crdd.osdd.net/drugpedia/images/QQ4.pdf]
-
 
+
==NetMHC-II Analysis==
==NetMHC-II Analysis==
Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br>
Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br>
-
Result Predicted by []
+
Result Predicted by [http://crdd.osdd.net/drugpedia/images/QQ45.pdf]
=External Links=
=External Links=

Current revision

Immunotation of Rv0444c
Name
Anti-sigma-K factor rskA
Identifiers
Swiss Prot O53729
Genbank 886346
PDB  ?
Chemical data
Formula C28H37ClN4O6 [1]
Mol. wt. 23883 Da
Pharmacokinetic data
Bioavailability  ?
Solubility  ?
Isoelectric-Point  ?

Contents

[edit] General

The gene rv0444c in mycobacterium tuberculosis genome codes for protein named Anti-sigma-K factor rskA.The function of this protein is to represses sigK, the extracytoplasmic function (ECF) sigma factor K, by binding to it and inhibiting its activity. This leads to a decreased expression of sigK-regulated genes, such as mpt70 and mpt83.It has recently been advanced that Mycobacterium tuberculosis sigma factor K (SigK) positively regulates expression of the antigenic proteins MPB70 and MPB83.Analysis of in vitro mpt70/mpt83 expression and Rv0444c sequencing across M. tuberculosis complex (MTC) members revealed that high-level expression was associated with a mutated Rv0444c.

[edit] Protein Sequence

>Rv0444c, TB.seq 533092:533787 MW:23884 MTEHTDFELLELATPYALNAVSDDERADIDRRVAAAPSPVAAAFNDEVRAVRETMAVVSAATTAEPPAHLRTAILDATKP EVRRQSRWRTAAFASAAAIAVGLGAFGLGVLTRPSPPPTVAEQVLTAPDVRTVSRPLGAGTATVVFSRDRNTGLLVMNNV APPSRGTVYQMWLLGGAKGPRSAGTMGTAAVTPSTTATLTDLGASTALAFTVEPGTGSPQPTGTILAELPLG


[edit] Human Homologue Blast Result

Identities = 16/29 (55%), Positives = 18/29 (62%), Gaps = 0/29 (0%) Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Identities = 24/82 (29%), Positives = 35/82 (42%), Gaps = 9/82 (10%) Identities = 28/110 (25%), Positives = 44/110 (40%), Gaps = 9/110 (8%)


subject ids% identity% positivesalignment length evalue
sp|Q9UPX8 33 33 93 0.32
sp|O14522 55 62 29 0.71
sp|Q9BPW9 48 61 31 0.90
sp|Q9UN74 29 42 82 1.8
sp|P42226 25 40 110 2.0

[edit] Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

[edit] Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

[edit] Subcellular Location

Link to TBpred
INTEGRAL MEMBRANE PROTEIN

[edit] Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

[edit] B cell Epitopes

[edit] BCEpred Analysis

Link to Bcepred
Result Predicited by [2]

[edit] ABCpred Analysis

Link to ABCpred
Result Predicited by [3]

[edit] IEDB Analysis

Link to IEDB
Result Predicited by [4]

[edit] MHC Class-I Binder

[edit] nHLAPred Analysis

Link to nHLApred
Result Predicited by [5]

[edit] IEDB Analysis

Link to IEDB
Result Predicted by [6]

[edit] MHC Class-II Binder

[edit] Propred Analysis

Link to Propred
Result Predicted by [7]

[edit] NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by [8]

[edit] External Links

  • Database of Mycobacterium tuberculosis genome sequences and related information.
Retrieved from "http://277988.efsst.group/drugpedia/index.php/Immunotation_of_Rv0444c"