Immunotation of Rv0015c
From DrugPedia: A Wikipedia for Drug discovery
| (5 intermediate revisions not shown.) | |||
| Line 15: | Line 15: | ||
=General= | =General= | ||
The Mycobacterium tuberculosis genome contains 11 serine/threonine kinase genes including two, pknA and pknB, that are part of an operon encoding genes involved in cell shape control and cell wall synthesis. Here we demonstrate that pknA and pknB are predominantly expressed during exponential growth, and that overexpression of these kinases slows growth and alters cell morphology. We determined the preferred substrate motifs of PknA and PknB, and identified three in vivo substrates of these kinases: PknB; Wag31, an ortholog of the cell division protein DivIVA | The Mycobacterium tuberculosis genome contains 11 serine/threonine kinase genes including two, pknA and pknB, that are part of an operon encoding genes involved in cell shape control and cell wall synthesis. Here we demonstrate that pknA and pknB are predominantly expressed during exponential growth, and that overexpression of these kinases slows growth and alters cell morphology. We determined the preferred substrate motifs of PknA and PknB, and identified three in vivo substrates of these kinases: PknB; Wag31, an ortholog of the cell division protein DivIVA | ||
| - | |||
| - | |||
| - | |||
| - | |||
| - | |||
| - | |||
| - | |||
| - | |||
==Protein Sequence== | ==Protein Sequence== | ||
| Line 32: | Line 24: | ||
PATGGHRPPRRTFSSGQRALLWAAGVLGALAIIIAVLLVIKAPGDNSPQQAPTPTVTTTGNPPASNTGGTDASPRLNWTE | PATGGHRPPRRTFSSGQRALLWAAGVLGALAIIIAVLLVIKAPGDNSPQQAPTPTVTTTGNPPASNTGGTDASPRLNWTE | ||
RGETRHSGLQSWVVPPTPHSRASLARYEIAQ | RGETRHSGLQSWVVPPTPHSRASLARYEIAQ | ||
| - | |||
=Human Homologue Blast Result= | =Human Homologue Blast Result= | ||
| Line 57: | Line 48: | ||
Link to [http://www.imtech.res.in/raghava/btxpred/submission.html btxpred]<br> | Link to [http://www.imtech.res.in/raghava/btxpred/submission.html btxpred]<br> | ||
No Hit Fountd by btxpred server. | No Hit Fountd by btxpred server. | ||
| + | =Subcellular Location= | ||
| + | Link to [http://www.imtech.res.in/raghava/tbpred/ TBpred]<br> | ||
| + | integral membrane protein | ||
| + | |||
| + | =Antigens= | ||
| + | No Hit Found in [http://www.imtech.res.in/raghava/antigendb/keyquery.html AntigenDB]<br> | ||
| + | No. Hit Found in [http://www.iedb.org/ IEDB] | ||
| + | ==B cell Epitopes== | ||
| + | ====BCEpred Analysis==== | ||
| + | |||
| + | Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred] | ||
| + | <br> | ||
| + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Bcepred_rv2753.pdf Bcepred]<br> | ||
| + | |||
| + | ====ABCpred Analysis==== | ||
| + | Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br> | ||
| + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/Abcpred_rv2753c.pdf ABCPred]<br> | ||
| + | |||
| + | ====IEDB Analysis==== | ||
| + | Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br> | ||
| + | Result Predicited by [http://crdd.osdd.net/drugpedia/images/IEDB_rv2753c.pdf IEDB]<br> | ||
| + | |||
| + | =MHC Class-I Binder= | ||
| + | ==nHLAPred Analysis== | ||
| + | Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred] | ||
| + | <br> | ||
| + | Result Predicited by [http://crdd.osdd.net/drugpedia/index.php/Image:Pri.txt]<br> | ||
| + | ==IEDB Analysis== | ||
| + | Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br> | ||
| + | Result Predicted by [http://crdd.osdd.net/drugpedia/index.php/Image:Prit1.txt] | ||
| + | |||
| + | =MHC Class-II Binder= | ||
| + | ==Propred Analysis== | ||
| + | Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br> | ||
| + | Result Predicted by [http://crdd.osdd.net/drugpedia/index.php/Image:Pp.txt] | ||
| + | |||
| + | |||
| + | ==NetMHC-II Analysis== | ||
| + | Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br> | ||
| + | Result Predicted by [http://crdd.osdd.net/drugpedia/index.php/Image:Ll.txt] | ||
| + | |||
| + | |||
| + | [[Category:C2D]] | ||
| + | [[Category:Mtb Immunotation]] | ||
Current revision
| Immunotation of Rv0015c
| |
| Name | |
| <Rv0015> transmembrane serine/threonine-protein kinase A pknA | |
| Identifiers | |
| Swiss Prot | |
| Genbank | |
| PDB | ? |
| Chemical data | |
| Formula | [] |
| Mol. wt. | 45596.9 |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 11.1868 |
Contents |
[edit] General
The Mycobacterium tuberculosis genome contains 11 serine/threonine kinase genes including two, pknA and pknB, that are part of an operon encoding genes involved in cell shape control and cell wall synthesis. Here we demonstrate that pknA and pknB are predominantly expressed during exponential growth, and that overexpression of these kinases slows growth and alters cell morphology. We determined the preferred substrate motifs of PknA and PknB, and identified three in vivo substrates of these kinases: PknB; Wag31, an ortholog of the cell division protein DivIVA
[edit] Protein Sequence
>Rv0015c, TB.seq 17470:18762 MW:45598 MSPRVGVTLSGRYRLQRLIATGGMGQVWEAVDNRLGRRVAVKVLKSEFSSDPEFIERFRAEARTTAMLNHPGIASVHDYG ESQMNGEGRTAYLVMELVNGEPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILITPTGQVKITDF GIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDASPASDVYSLGVVGYEAVSGKRPFAGDGALTVAMKHIKEPPPPLPPD LPPNVRELIEITLVKNPAMRYRSGGPFADAVAAVRAGRRPPRPSQTPPPGRAAPAAIPSGTTARVAANSAGRTAASRRSR PATGGHRPPRRTFSSGQRALLWAAGVLGALAIIIAVLLVIKAPGDNSPQQAPTPTVTTTGNPPASNTGGTDASPRLNWTE RGETRHSGLQSWVVPPTPHSRASLARYEIAQ
[edit] Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|Q9UBS0 | 31 | 50 | 259 | 2e-26 |
| sp|Q8TD08 | 32 | 48 | 238 | 1e-25 |
| sp|Q8TDC3 | 28 | 45 | 286 | 1e-25 |
| sp|P22612 | 31 | 47 | 250 | 1e-25 |
| sp|Q9P0L2 | 33 | 48 | 225 | 2e-25 |
[edit] Alergen Protein
Link to Algpred
Non Allergen Predicted by AlgPred Server
[edit] Bacterial Toxin Prediction
Link to btxpred
No Hit Fountd by btxpred server.
[edit] Subcellular Location
Link to TBpred
integral membrane protein
[edit] Antigens
No Hit Found in AntigenDB
No. Hit Found in IEDB
[edit] B cell Epitopes
[edit] BCEpred Analysis
Link to Bcepred
Result Predicited by Bcepred
[edit] ABCpred Analysis
Link to ABCpred
Result Predicited by ABCPred
[edit] IEDB Analysis
Link to IEDB
Result Predicited by IEDB
[edit] MHC Class-I Binder
[edit] nHLAPred Analysis
Link to nHLApred
Result Predicited by [1]
[edit] IEDB Analysis
Link to IEDB
Result Predicted by [2]
[edit] MHC Class-II Binder
[edit] Propred Analysis
Link to Propred
Result Predicted by [3]
