Immunoatation of Rv2711

From DrugPedia: A Wikipedia for Drug discovery

(Difference between revisions)
Jump to: navigation, search
(New page: {{immunebox | Name =<b>IRON-dependent repressor and activator IDER</b> |image= | width=250 |image2= |Swiss Prot = P0A672 | Genbank = 888590 | PDB = 1FX7 | Drug...)
Current revision (09:56, 26 January 2010) (edit) (undo)
(→Propred Analysis)
 
(10 intermediate revisions not shown.)
Line 9: Line 9:
| DrugBank          =
| DrugBank          =
| chemical_formula  =  
| chemical_formula  =  
-
| molecular_weight  = 24855.0
+
| molecular_weight  = 25232.7
| solubility        =  
| solubility        =  
-
|Isoelectric-Point = 4.6
+
|Isoelectric-Point = 5.05
}}
}}
=General=
=General=
 +
The mycobacterial IdeR protein is a metal-dependent regulator of the DtxR (diphtheria toxin repressor) family. In the presence of iron, it binds to a specific DNA sequence in the promoter regions of the genes that it regulates, thus controlling their transcription.A study has provided the evidence of ideR as an essential gene in Mycobacterium tuberculosis. ideR cannot normally be disrupted in this mycobacterium in the absence of a second functional copy of the gene. However, a rare ideR mutant was obtained in which the lethal effects of ideR inactivation were alleviated by a second-site suppressor mutation and which exhibited restricted iron assimilation capacity. Studies of this strain and a derivative in which IdeR expression was restored allowed to identify phenotypic effects resulting from ideR inactivation. Using DNA microarrays, the iron-dependent transcriptional profiles of the wild-type, ideR mutant, and ideR-complemented mutant strains were analyzed, and the genes regulated by iron and IdeR were identified. These genes encode a variety of proteins, including putative transporters, proteins involved in siderophore synthesis and iron storage, members of the PE/PPE family, a membrane protein involved in virulence, transcriptional regulators, and enzymes involved in lipid metabolism.
 +
==Protein Sequence==
 +
>Rv2711, TB.seq  3023562:3024251 MW:25234
 +
MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHR
 +
LAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLVELGVGPEPGADDANLVRLTELPAG
 +
SPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETTPGGGVTIVIPGHENVTLPHEMAHAVKVEKV
 +
 +
=Human Homologue Blast Result=
 +
 +
<table border='1'><tr>
 +
 +
<td>subject ids</td><td>% identity</td><td>% positives</td><td>alignment length</td><td> evalue</td></tr>
 +
 +
<tr><td>sp|P07358</td><td> 30</td><td> 53</td><td> 39</td><td> 0.87</td></tr>
 +
 +
<tr><td>sp|Q8TEQ8</td><td> 40</td><td> 54</td><td> 35</td><td> 2.4</td></tr>
 +
 +
<tr><td>sp|Q9P273</td><td> 32</td><td> 50</td><td> 46</td><td> 5.2</td></tr>
 +
 +
<tr><td>sp|Q9NZQ8</td><td> 33</td><td> 50</td><td> 54</td><td> 7.5</td></tr>
 +
 +
<tr><td>sp|P25092</td><td> 27</td><td> 46</td><td> 80</td><td> 9.2</td></tr></table>
 +
 +
=Alergen Protein=
 +
Link to [http://www.imtech.res.in/raghava/algpred/ Algpred]<br>
 +
Non Allergen Predicted by AlgPred Server
 +
 +
=Bacterial Toxin Prediction=
 +
Link to [http://www.imtech.res.in/raghava/btxpred/submission.html btxpred]<br>
 +
No Hit Fountd by btxpred server.
 +
 +
=Subcellular Location=
 +
Link to [http://www.imtech.res.in/raghava/tbpred/ TBpred]<br>
 +
Cyoplasmic
 +
 +
=Antigens=
 +
No Hit Found in [http://www.imtech.res.in/raghava/antigendb/keyquery.html AntigenDB]<br>
 +
No. Hit Found in [http://www.iedb.org/ IEDB]
 +
 +
==B cell Epitopes==
 +
====BCEpred Analysis====
 +
 +
Link to [http://www.imtech.res.in/raghava/bcepred/bcepred_submission.html Bcepred] 
 +
<br>
 +
Result Predicited by  [http://crdd.osdd.net/drugpedia/images/Amit.pdf]<br>
 +
 +
====ABCpred Analysis====
 +
Link to [http://www.imtech.res.in/raghava/abcpred/ABC_submission.html ABCpred]<br>
 +
Result Predicited by  [http://crdd.osdd.net/drugpedia/images/Amit1.pdf]<br>
 +
 +
====IEDB Analysis====
 +
Link to [http://tools.immuneepitope.org/tools/bcell/iedb_input IEDB]<br>
 +
Result Predicited by  [http://crdd.osdd.net/drugpedia/images/Amit2.pdf]<br>
 +
 +
=MHC Class-I Binder=
 +
==nHLAPred Analysis==
 +
Link to [http://www.imtech.res.in/raghava/nhlapred/comp.html nHLApred]
 +
<br>
 +
Result Predicited by  [http://crdd.osdd.net/drugpedia/images/Amit3.pdf]<br>
 +
==IEDB Analysis==
 +
Link to [http://tools.immuneepitope.org/analyze/html/mhc_processing.html IEDB] <br>
 +
Result Predicted by [http://crdd.osdd.net/drugpedia/images/Amit4.pdf]
 +
 +
=MHC Class-II Binder=
 +
==Propred Analysis==
 +
Link to [http://www.imtech.res.in/raghava/propred/ Propred]<br>
 +
Result Predicted by [http://crdd.osdd.net/drugpedia/images/Amit6.pdf]
 +
 +
==NetMHC-II Analysis==
 +
Link to [http://www.cbs.dtu.dk/services/NetMHCII/ NetMHC-II]<br>
 +
Result Predicted by [http://crdd.osdd.net/drugpedia/images/Amit5.pdf]
 +
 +
=External Links=
 +
* [http://www.biohealthbase.org/mycobacterium Database] of ''Mycobacterium tuberculosis'' genome sequences and related information.
 +
 +
[[Category:C2D]]
 +
[[Category:Mtb Immunotation]]

Current revision

Immunoatation of Rv2711
Name
IRON-dependent repressor and activator IDER
Identifiers
Swiss Prot P0A672
Genbank 888590
PDB 1FX7
Chemical data
Formula  ?
Mol. wt. 25232.7
Pharmacokinetic data
Bioavailability  ?
Solubility  ?
Isoelectric-Point 5.05

Contents

[edit] General

The mycobacterial IdeR protein is a metal-dependent regulator of the DtxR (diphtheria toxin repressor) family. In the presence of iron, it binds to a specific DNA sequence in the promoter regions of the genes that it regulates, thus controlling their transcription.A study has provided the evidence of ideR as an essential gene in Mycobacterium tuberculosis. ideR cannot normally be disrupted in this mycobacterium in the absence of a second functional copy of the gene. However, a rare ideR mutant was obtained in which the lethal effects of ideR inactivation were alleviated by a second-site suppressor mutation and which exhibited restricted iron assimilation capacity. Studies of this strain and a derivative in which IdeR expression was restored allowed to identify phenotypic effects resulting from ideR inactivation. Using DNA microarrays, the iron-dependent transcriptional profiles of the wild-type, ideR mutant, and ideR-complemented mutant strains were analyzed, and the genes regulated by iron and IdeR were identified. These genes encode a variety of proteins, including putative transporters, proteins involved in siderophore synthesis and iron storage, members of the PE/PPE family, a membrane protein involved in virulence, transcriptional regulators, and enzymes involved in lipid metabolism.

[edit] Protein Sequence

>Rv2711, TB.seq 3023562:3024251 MW:25234 MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHR LAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLVELGVGPEPGADDANLVRLTELPAG SPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETTPGGGVTIVIPGHENVTLPHEMAHAVKVEKV

[edit] Human Homologue Blast Result

subject ids% identity% positivesalignment length evalue
sp|P07358 30 53 39 0.87
sp|Q8TEQ8 40 54 35 2.4
sp|Q9P273 32 50 46 5.2
sp|Q9NZQ8 33 50 54 7.5
sp|P25092 27 46 80 9.2

[edit] Alergen Protein

Link to Algpred
Non Allergen Predicted by AlgPred Server

[edit] Bacterial Toxin Prediction

Link to btxpred
No Hit Fountd by btxpred server.

[edit] Subcellular Location

Link to TBpred
Cyoplasmic

[edit] Antigens

No Hit Found in AntigenDB
No. Hit Found in IEDB

[edit] B cell Epitopes

[edit] BCEpred Analysis

Link to Bcepred
Result Predicited by [1]

[edit] ABCpred Analysis

Link to ABCpred
Result Predicited by [2]

[edit] IEDB Analysis

Link to IEDB
Result Predicited by [3]

[edit] MHC Class-I Binder

[edit] nHLAPred Analysis

Link to nHLApred
Result Predicited by [4]

[edit] IEDB Analysis

Link to IEDB
Result Predicted by [5]

[edit] MHC Class-II Binder

[edit] Propred Analysis

Link to Propred
Result Predicted by [6]

[edit] NetMHC-II Analysis

Link to NetMHC-II
Result Predicted by [7]

[edit] External Links

  • Database of Mycobacterium tuberculosis genome sequences and related information.
Retrieved from "http://277988.efsst.group/drugpedia/index.php/Immunoatation_of_Rv2711"