Immunotation of rv1980c
From DrugPedia: A Wikipedia for Drug discovery
| Line 15: | Line 15: | ||
=General= | =General= | ||
Entry Rv1980c of M.tuberculosis has its gene name as mpt64 and gene product as immunogenic protein MPT64. The MPT64 protein and its homologs form a highly conserved family of secreted proteins with unknown function. The founding member of this family from Mycobacterium tuberculosis (MPT64 or protein Rv1980c) is expressed only when Mycobacteria cells are actively dividing. Examination of the Rv1980c structure in conjunction with multiple sequence alignments of MPT64 homologs identifies a candidate ligand-binding site, which may help guide future studies of Rv1980c function. A comparison showed mpt64 and the gene encoding MPB64 from Mycobacterium bovis BCG Tokyo to be identical except for one silent mutation . | Entry Rv1980c of M.tuberculosis has its gene name as mpt64 and gene product as immunogenic protein MPT64. The MPT64 protein and its homologs form a highly conserved family of secreted proteins with unknown function. The founding member of this family from Mycobacterium tuberculosis (MPT64 or protein Rv1980c) is expressed only when Mycobacteria cells are actively dividing. Examination of the Rv1980c structure in conjunction with multiple sequence alignments of MPT64 homologs identifies a candidate ligand-binding site, which may help guide future studies of Rv1980c function. A comparison showed mpt64 and the gene encoding MPB64 from Mycobacterium bovis BCG Tokyo to be identical except for one silent mutation . | ||
| + | |||
Inhibition of apoptosis of infected macrophages by pathogenic mycobacteria is suggested to be an important virulence mechanism, but little is known about the mycobacterial proteins involved in the inhibition of apoptosis.one of the predominant proteins involved in apoptosis is MPT64. | Inhibition of apoptosis of infected macrophages by pathogenic mycobacteria is suggested to be an important virulence mechanism, but little is known about the mycobacterial proteins involved in the inhibition of apoptosis.one of the predominant proteins involved in apoptosis is MPT64. | ||
| + | |||
NR-13273 is a recombinant expression vector containing Mycobacterium tuberculosis gene Rv1980c, which encodes the secreted immunogenic protein Mpt64. Gene Rv1980c was amplified by PCR and cloned into pET15b for expression in Escherichia coli. The gene was cloned without a signal sequence. The expressed protein is histidine-tagged and has an observed molecular weight of 25 kDa. The expected purified protein yield from a one liter culture is approximately 3 mg. | NR-13273 is a recombinant expression vector containing Mycobacterium tuberculosis gene Rv1980c, which encodes the secreted immunogenic protein Mpt64. Gene Rv1980c was amplified by PCR and cloned into pET15b for expression in Escherichia coli. The gene was cloned without a signal sequence. The expressed protein is histidine-tagged and has an observed molecular weight of 25 kDa. The expected purified protein yield from a one liter culture is approximately 3 mg. | ||
==Protein Sequence== | ==Protein Sequence== | ||
| Line 28: | Line 30: | ||
<td>subject ids</td><td>% identity</td><td>% positives</td><td>alignment length</td><td> evalue</td></tr> | <td>subject ids</td><td>% identity</td><td>% positives</td><td>alignment length</td><td> evalue</td></tr> | ||
| - | <tr><td></td><td> </td><td> </td><td> </td><td> </td></tr> | + | <tr><td>sp|Q13464</td><td> 23</td><td> 42</td><td> 148</td><td> 0.14</td></tr> |
| + | |||
| + | <tr><td>sp|P98155</td><td> 29</td><td> 42</td><td> 100</td><td> 0.50</td></tr> | ||
| - | <tr><td></td><td> </td><td> </td><td> </td><td> </td></tr> | + | <tr><td>sp|Q8N6C5</td><td> 24</td><td> 37</td><td> 90</td><td> 2.3</td></tr> |
| - | <tr><td></td><td> </td><td> </td><td> </td><td> </td></tr> | + | <tr><td>sp|Q8NG31</td><td> 25</td><td> 45</td><td> 55</td><td> 2.7</td></tr> |
| - | <tr><td></td><td> </td><td> </td><td> </td><td> </td></tr> | + | <tr><td>sp|Q8WW52</td><td> 34</td><td> 48</td><td> 72</td><td> 3.1</td></tr></table> |
| - | + | =Alergen Protein= | |
Revision as of 07:34, 21 January 2010
| Immunotation of rv1980c
| |
| Name | |
| Identifiers | |
| Swiss Prot | |
| Genbank | |
| PDB | |
| Chemical data | |
| Formula | [1] |
| Mol. wt. | 24,824Da |
| Pharmacokinetic data | |
| Bioavailability | ? |
| Solubility | ? |
| Isoelectric-Point | 4.5994 |
Contents |
General
Entry Rv1980c of M.tuberculosis has its gene name as mpt64 and gene product as immunogenic protein MPT64. The MPT64 protein and its homologs form a highly conserved family of secreted proteins with unknown function. The founding member of this family from Mycobacterium tuberculosis (MPT64 or protein Rv1980c) is expressed only when Mycobacteria cells are actively dividing. Examination of the Rv1980c structure in conjunction with multiple sequence alignments of MPT64 homologs identifies a candidate ligand-binding site, which may help guide future studies of Rv1980c function. A comparison showed mpt64 and the gene encoding MPB64 from Mycobacterium bovis BCG Tokyo to be identical except for one silent mutation .
Inhibition of apoptosis of infected macrophages by pathogenic mycobacteria is suggested to be an important virulence mechanism, but little is known about the mycobacterial proteins involved in the inhibition of apoptosis.one of the predominant proteins involved in apoptosis is MPT64.
NR-13273 is a recombinant expression vector containing Mycobacterium tuberculosis gene Rv1980c, which encodes the secreted immunogenic protein Mpt64. Gene Rv1980c was amplified by PCR and cloned into pET15b for expression in Escherichia coli. The gene was cloned without a signal sequence. The expressed protein is histidine-tagged and has an observed molecular weight of 25 kDa. The expected purified protein yield from a one liter culture is approximately 3 mg.
Protein Sequence
>Rv1980c, TB.seq 2223344:2224027 MW:24824 VRIKIFMLVTAVVLLCCSGVATAAPKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSA ATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFP IVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA
Human Homologue Blast Result
| subject ids | % identity | % positives | alignment length | evalue |
| sp|Q13464 | 23 | 42 | 148 | 0.14 |
| sp|P98155 | 29 | 42 | 100 | 0.50 |
| sp|Q8N6C5 | 24 | 37 | 90 | 2.3 |
| sp|Q8NG31 | 25 | 45 | 55 | 2.7 |
| sp|Q8WW52 | 34 | 48 | 72 | 3.1 |
